Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A0FGR8-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
24-41 (18) GAEPPGISASTQPASAGR PA
0
45-53 (9) HCGAMSGAR PA
0
54-67 (14) GEGPEAGAGGAGGR PA
0
68-90 (23) AAPENPGGVLSVELPGLLAQLAR PA
0
91-122 (32) SFALLLPVYALGYLGLSFSWVLLALALLAWCR PA
2
135-144 (10) ALALLEDEER PA
2
152-166 (15) ACDLPAWVHFPDTER PA
2
176-187 (12) HMWPFICQFIEK PA
2
191-198 (8) ETIEPAVR PA
3
199-211 (13) GANTHLSTFSFTK PA
3
212-220 (9) VDVGQQPLR PA
3
226-233 (8) VYTENVDK PA
3
235-255 (21) QIILDLQISFVGNCEIDLEIK PA
3
265-273 (9) SIQIHGTMR PA
3
274-295 (22) VILEPLIGDMPLVGALSIFFLR PA
3
296-336 (41) KPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLVLPNR PA
3
337-351 (15) ITVPLVSEVQIAQLR PA
3
361-372 (12) IHFIEAQDLQGK PA
3
384-391 (8) SDPYGIIR PA
3
392-400 (9) VGNQIFQSR PA
3
410-437 (28) WNEVYEALVYEHPGQELEIELFDEDPDK PA
3
438-453 (16) DDFLGSLMIDLIEVEK PA
3
456-468 (13) LLDEWFTLDEVPK PA
3
475-489 (15) LEWLTLMPNASNLDK PA
3
499-518 (20) DQANDGLSSALLILYLDSAR PA
3
526-541 (16) ISSNPNPVVQMSVGHK PA
3
551-568 (18) TNEPVWEENFTFFIHNPK PA
3
570-577 (8) QDLEVEVR PA
3
578-589 (12) DEQHQCSLGNLK PA
4
590-606 (17) VPLSQLLTSEDMTVSQR PA
4
607-619 (13) FQLSNSGPNSTIK PA
4
633-645 (13) ERPPDHQHSAQVK PA
4
660-691 (32) SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK PA
3
692-707 (16) AQPPEAGPQGLHDLGR PA
3
708-722 (15) SSSSLLASPGHISVK PA
3
723-742 (20) EPTPSIASDISLPIATQELR PA
3
747-767 (21) QLENGTTLGQSPLGQIQLTIR PA
3
775-783 (9) LIVVVHACR PA
3
784-798 (15) NLIAFSEDGSDPYVR PA
3
819-839 (21) TLNPVFDQSFDFSVSLPEVQR PA
3
848-855 (8) NSGGFLSK PA
3
863-874 (12) VLVALASEELAK PA
3
875-893 (19) GWTQWYDLTEDGTRPQAMT PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center