Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A0FGR8-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MWPFICQFIEK PA
0
15-22 (8) ETIEPAVR PA
3
23-35 (13) GANTHLSTFSFTK PA
3
36-44 (9) VDVGQQPLR PA
3
50-57 (8) VYTENVDK PA
3
59-79 (21) QIILDLQISFVGNCEIDLEIK PA
3
89-97 (9) SIQIHGTMR PA
3
98-119 (22) VILEPLIGDMPLVGALSIFFLR PA
3
120-160 (41) KPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLVLPNR PA
3
161-175 (15) ITVPLVSEVQIAQLR PA
3
185-196 (12) IHFIEAQDLQGK PA
3
208-215 (8) SDPYGIIR PA
3
216-224 (9) VGNQIFQSR PA
3
234-261 (28) WNEVYEALVYEHPGQELEIELFDEDPDK PA
3
262-277 (16) DDFLGSLMIDLIEVEK PA
3
280-292 (13) LLDEWFTLDEVPK PA
3
299-313 (15) LEWLTLMPNASNLDK PA
3
323-342 (20) DQANDGLSSALLILYLDSAR PA
3
350-365 (16) ISSNPNPVVQMSVGHK PA
3
375-392 (18) TNEPVWEENFTFFIHNPK PA
3
394-401 (8) QDLEVEVR PA
3
402-413 (12) DEQHQCSLGNLK PA
4
414-430 (17) VPLSQLLTSEDMTVSQR PA
4
431-443 (13) FQLSNSGPNSTIK PA
4
457-469 (13) ERPPDHQHSAQVK PA
4
484-505 (22) SHMSGSPGPGGSNTAPSTSQSR PA
0
506-513 (8) SRPPASPR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center