Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A0FGR8-6)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-13 (8) DAALSSHR PA
1
14-22 (9) HPGCAQRPR PA
1
23-32 (10) TPTFASSSQR PA
1
34-49 (16) SAFGFDDGNFPGLGER PA
1
76-88 (13) GAGAGLSRPGSAR PA
1
89-118 (30) APSPPRPGGPENPGGVLSVELPGLLAQLAR PA
1
119-150 (32) SFALLLPVYALGYLGLSFSWVLLALALLAWCR PA
2
163-172 (10) ALALLEDEER PA
2
180-194 (15) ACDLPAWVHFPDTER PA
2
204-215 (12) HMWPFICQFIEK PA
2
219-226 (8) ETIEPAVR PA
3
227-239 (13) GANTHLSTFSFTK PA
3
240-248 (9) VDVGQQPLR PA
3
254-261 (8) VYTENVDK PA
3
263-283 (21) QIILDLQISFVGNCEIDLEIK PA
3
293-301 (9) SIQIHGTMR PA
3
302-323 (22) VILEPLIGDMPLVGALSIFFLR PA
3
324-364 (41) KPLLEINWTGLTNLLDVPGLNGLSDTIILDIISNYLVLPNR PA
3
365-379 (15) ITVPLVSEVQIAQLR PA
3
389-400 (12) IHFIEAQDLQGK PA
3
412-419 (8) SDPYGIIR PA
3
420-428 (9) VGNQIFQSR PA
3
438-465 (28) WNEVYEALVYEHPGQELEIELFDEDPDK PA
3
466-481 (16) DDFLGSLMIDLIEVEK PA
3
484-496 (13) LLDEWFTLDEVPK PA
3
503-517 (15) LEWLTLMPNASNLDK PA
3
527-546 (20) DQANDGLSSALLILYLDSAR PA
3
547-561 (15) NLPSNPLEFNPDVLK PA
0
575-590 (16) ISSNPNPVVQMSVGHK PA
3
600-617 (18) TNEPVWEENFTFFIHNPK PA
3
619-626 (8) QDLEVEVR PA
3
627-638 (12) DEQHQCSLGNLK PA
4
639-655 (17) VPLSQLLTSEDMTVSQR PA
4
656-668 (13) FQLSNSGPNSTIK PA
4
682-694 (13) ERPPDHQHSAQVK PA
4
709-740 (32) SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK PA
3
741-756 (16) AQPPEAGPQGLHDLGR PA
3
757-771 (15) SSSSLLASPGHISVK PA
3
772-791 (20) EPTPSIASDISLPIATQELR PA
3
796-816 (21) QLENGTTLGQSPLGQIQLTIR PA
3
824-832 (9) LIVVVHACR PA
3
833-847 (15) NLIAFSEDGSDPYVR PA
3
868-888 (21) TLNPVFDQSFDFSVSLPEVQR PA
3
897-904 (8) NSGGFLSK PA
3
912-923 (12) VLVALASEELAK PA
3
924-942 (19) GWTQWYDLTEDGTRPQAMT PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center