Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A0PG75-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-87 (76) GLPGFLPGAPDPDQSLPASSNPGNQAWQLSLPLPSSFLPTVSLPPGLEYLSQLDLIIIHQQVELLGMILGTETSNK PA
0
98-110 (13) IYFAVEESICFNR PA
1
130-139 (10) EVITVNRPLR PA
1
140-168 (29) CNSCWCPCYLQELEIQAPPGTIVGYVTQK PA
1
176-183 (8) FTIQNANK PA
1
189-207 (19) IVGPCVTCGCFGDVDFEVK PA
1
221-249 (29) YWSGFVNDVFTNADNFGIHVPADLDVTVK PA
1
250-271 (22) AAMIGACFLFDFMFFEHSLAGL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center