Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A1A4F0-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-27 (19) VNTANSSTDTSGEHLTCLR PA
3
28-35 (8) SQLFVAYR PA
3
39-60 (22) VDEAVSLGFLDCWIGGDLTNFK PA
3
61-80 (20) GCYLTNQLPIQDIPTSVIQR PA
0
86-127 (42) ESQIVTLGSPLPCIYPIFFQISEISMPGYYSCLCHTTINTSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center