Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A1L157-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-17 (12) TEQDDWLIIYLK PA
0
18-45 (28) YLLFVFNFFFWVGGAAVLAVGIWTLVEK PA
0
46-86 (41) SGYLSVLASSTFAASAYILIFAGVLVMVTGFLGFGAILWER PA
0
88-117 (30) GCLSTYFCLLLVIFLVELVAGVLAHVYYQR PA
0
129-148 (20) TLAENYGQPGATQITASVDR PA
0
155-173 (19) CCGSNSSADWQHSTYILLR PA
0
179-186 (8) QVPDSCCK PA
0
196-203 (8) AHPSNIYK PA
0
204-211 (8) VEGGCLTK PA
0
212-247 (36) LEQFLADHLLLMGAVGIGVACLQICGMVLTCCLHQR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center