Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A2VCL2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-36 (20) TLQLIAPLHDIVAYLVSFAK PA
2
37-48 (12) LGNCPACFEFPR PA
2
55-85 (31) GDWGGTEGIGSELQELQNMIDSLQSPQDPIR PA
1
86-93 (8) VAQALLLR PA
1
95-106 (12) EVIFLQFDAAVR PA
1
112-141 (30) TFLAAGNVPAYQSVTDGMCHGLPALSNSLR PA
1
143-158 (16) SIFASQLSLPQPLDPR PA
1
159-169 (11) SLQAFELFPWR PA
1
170-195 (26) AFLEDGGPFPVMSNSPDTLEYNMQVG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center