Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A2VCL2-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-36 (20) TLQLIAPLHDIVAYLVSFAK PA
2
37-48 (12) LGNCPACFEFPR PA
2
55-85 (31) GDWGGTEGIGSELQELQNMIDSLQSPQDPIR PA
1
86-93 (8) VAQALLLR PA
1
95-106 (12) EVIFLQFDAAVR PA
1
112-141 (30) TFLAAGNVPAYQSVTDGMCHGLPALSNSLR PA
1
143-158 (16) SIFASQLSLPQPLDPR PA
1
159-169 (11) SLQAFELFPWR PA
1
170-202 (33) AFLEDGGPFPVMSNSPDTLEYNMQLCLCGLSDR PA
0
206-234 (29) VAHGELVGVQLLLEDVLSSYHVTMEAPQR PA
0
242-249 (8) NTQPDWSK PA
0
263-281 (19) TSELLEGLCDAVMSFALLR PA
0
302-314 (13) LQGQDINSVSLHK PA
0
316-330 (15) FSELYETDVLYPSMK PA
0
339-364 (26) EDEFEGFIVNNQSVLPPSGASEVEIK PA
0
371-385 (15) LLENCEIQMIQEVLR PA
0
390-398 (9) EMTLVLSEK PA
0
401-411 (11) EECSLPTDLWK PA
0
417-429 (13) ENFSVSRPQIVEK PA
0
434-447 (14) LMNYQDDGVEITFR PA
0
449-465 (17) DHLEACLLSLGCDVMAR PA
0
466-485 (20) ECSNFETYSMCYEHVLHHAR PA
0
492-500 (9) EQELDATQR PA
0
501-527 (27) GQGPPEDSAGQIAELSHDMIMEITTLR PA
0
528-541 (14) AQLTDLEEVNLNLK PA
0
547-557 (11) EVQEEYEALVR PA
0
558-567 (10) ALFETCLHIK PA
0
570-580 (11) LDDNQLNLIQK PA
0
581-589 (9) VCELIGEVR PA
0
590-597 (8) TEGIDNMK PA
0
603-613 (11) WCSASPDEGMK PA
0
619-637 (19) EQLWALEQDNCSLANLVCK PA
0
646-659 (14) LAVQQACFQAQLSR PA
0
709-718 (10) QQDSQAQLLK PA
0
724-738 (15) VTQEALTQQQLHFMK PA
0
745-752 (8) LLEDVGQK PA
0
753-761 (9) EQQLQLLSK PA
0
802-814 (13) AEELQGQLHDAQR PA
0
815-841 (27) SAVPMGSSGDLISQAQYSPTSASTSSR PA
0
860-870 (11) WIQRPQTVPIK PA
0
875-900 (26) TDDVFLPNMAENVQLTAFQVQTAPSR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center