Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A4D0S4-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MQFQLTLFLHLGWLSYSK PA
2
26-39 (14) GACHPTTGDLLVGR PA
2
40-53 (14) NTQLMASSTCGLSR PA
2
57-68 (12) YCILSYLEGEQK PA
2
76-100 (25) FPYDPYDQPNSHTIENVIVSFEPDR PA
2
104-117 (14) WWQSENGLDHVSIR PA
2
118-125 (8) LDLEALFR PA
2
126-134 (9) FSHLILTFK PA
2
135-145 (11) TFRPAAMLVER PA
3
146-154 (9) STDYGHNWK PA
2
162-186 (25) DCATSFPNITSGQAQGVGDIVCDSK PA
2
187-201 (15) YSDIEPSTGGEVVLK PA
2
202-227 (26) VLDPSFEIENPYSPYIQDLVTLTNLR PA
2
233-243 (11) LHTLGDALLGR PA
2
252-262 (11) YYYALYEMIVR PA
2
263-279 (17) GSCFCNGHASECRPMQK PA
2
282-308 (27) GDVFSPPGMVHGQCVCQHNTDGPNCER PA
2
311-330 (20) DFFQDAPWRPAADLQDNACR PA
2
331-340 (10) SCSCNSHSSR PA
2
341-373 (33) CHFDMTTYLASGGLSGGVCEDCQHNTEGQHCDR PA
2
385-426 (42) TISDPYACIPCECDPDGTISGGICVSHSDPALGSVAGQCLCK PA
2
434-521 (88) CDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSYVTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGA
YSNVCSPK PA
2
522-534 (13) NGQCECRPHVTGR PA
2
535-600 (66) SCSEPAPGYFFAPLNFYLYEAEEATTLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFAR PA
2
601-608 (8) VLPGAGLR PA
2
609-652 (44) FAVNNIPFPVDFTIAIHYETQSAADWTVQIVVNPPGGSEHCIPK PA
2
653-668 (16) TLQSKPQSFALPAATR PA
2
669-724 (56) IMLLPTPICLEPDVQYSIDVYFSQPLQGESHAHSHVLVDSLGLIPQINSLENFCSK PA
1
725-753 (29) QDLDEYQLHNCVEIASAMGPQVLPGACER PA
1
754-761 (8) LIISMSAK PA
1
762-770 (9) LHDGAVACK PA
1
771-783 (13) CHPQGSVGSSCSR PA
1
784-797 (14) LGGQCQCKPLVVGR PA
1
802-825 (24) CSTGSYDLGHHGCHPCHCHPQGSK PA
1
826-845 (20) DTVCDQVTGQCPCHGEVSGR PA
1
850-867 (18) CLAGYFGFPSCHPCPCNR PA
1
868-889 (22) FAELCDPETGSCFNCGGFTTGR PA
1
894-961 (68) CIDGYYGNPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNPR PA
1
962-986 (25) ISGAPCQPCACNNNIDVTDPESCSR PA
1
994-1020 (27) CLHNTQGANCQLCKPGHYGSALNQTCR PA
1
1022-1063 (42) CSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLACDR PA
1
1064-1075 (12) CADGYWNLVPGR PA
1
1076-1085 (10) GCQSCDCDPR PA
1
1086-1102 (17) TSQSSHCDQLTGQCPCK PA
1
1110-1124 (15) CSECQENYYGDPPGR PA
1
1125-1132 (8) CIPCDCNR PA
1
1133-1148 (16) AGTQKPICDPDTGMCR PA
1
1164-1191 (28) GHSQEFPTCLQCHLCFDQWDHTISSLSK PA
1
1199-1206 (8) LAANMEDK PA
1
1208-1218 (11) ETLPVCEADFK PA
1
1222-1229 (8) GNVSEIER PA
1
1233-1240 (8) HPVFPSGK PA
1
1254-1263 (10) QIMQLNEQLK PA
1
1264-1272 (9) AVYEFQDLK PA
1
1280-1312 (33) NEADLLLEDLQEEIDLQSSVLNASIADSSENIK PA
1
1314-1323 (10) YYHISSSAEK PA
1
1325-1339 (15) INETSSTINTSANTR PA
1
1340-1352 (13) NDLLTILDTLTSK PA
1
1365-1374 (10) IPDIQILNEK PA
1
1375-1397 (23) VCGDPGNVPCVPLPCGGALCTGR PA
1
1405-1421 (17) GPGCHGSLTLSTNALQK PA
1
1441-1454 (14) NQIESISEQAEVSK PA
1
1469-1483 (15) NQSDSEEENINLFIK PA
1
1487-1501 (15) NFLLEENVPPEDIEK PA
1
1502-1524 (23) VANGVLDIHLPIPSQNLTDELVK PA
1
1528-1536 (9) HMQLCEDYR PA
1
1542-1551 (10) LNEEADGAQK PA
1
1562-1571 (10) AANILLNLDK PA
1
1572-1585 (14) TLNQLQQAQITQGR PA
1
1586-1599 (14) ANSTITQLTANITK PA
1
1603-1612 (10) NVLQAENQTR PA
1
1625-1637 (13) SGLEDGLSLLQTK PA
1
1641-1649 (9) HQDHAVNAK PA
1
1650-1664 (15) VQAESAQHQAGSLEK PA
1
1680-1687 (8) TSTTGLTK PA
1
1703-1710 (8) LAGDTEAK PA
1
1714-1723 (10) ITGCFQNSAR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center