Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A4D1S0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-37 (37) MEESWEAAPGGQAGAELPMEPVGSLVPTLEQPQVPAK PA
1
40-56 (17) QPEGPESSPSPAGAVEK PA
1
57-67 (11) AAGAGLEPSSK PA
1
69-79 (11) KPPSPRPGSPR PA
1
80-102 (23) VPPLSLGYGVCPEPPSPGPALVK PA
1
106-129 (24) NGEAPGAEPAPSAWAPMELQVDVR PA
1
130-149 (20) VKPVGAAGGSSTPSPRPSTR PA
1
153-163 (11) VPVPESPAFSR PA
1
164-174 (11) HADPAHQLLLR PA
1
175-184 (10) APSQGGTWGR PA
1
193-202 (10) TESGCDAEGR PA
1
203-220 (18) ASPAEGSAGSPGSPTCCR PA
1
229-236 (8) EDAALLPR PA
1
237-244 (8) AGLDGDEK PA
1
248-256 (9) AVTLTDSLR PA
0
260-270 (11) TIWISTVGPWR PA
0
274-289 (16) WWLQTAALQDPGSVPR PA
0
290-314 (25) GPSDLGSAWSSACQADAAPPTGEAS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center