Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A4D1S5-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MHFSSSAR PA
1
9-19 (11) AADENFDYLFK PA
1
20-30 (11) IILIGDSNVGK PA
1
31-38 (8) TCVVQHFK PA
1
39-57 (19) SGVYTETQQNTIGVDFTVR PA
1
68-87 (20) NSSASIITFASIQIHGQTQK PA
0
88-95 (8) MSPQIWTK PA
0
96-125 (30) SSHYLWEPLIWTLLPVLLQMQVWDTAGQER PA
0
128-135 (8) TITQSYYR PA
3
136-148 (13) SAHAAIIAYDLTR PA
1
150-164 (15) STFESIPHWIHEIEK PA
1
165-178 (14) YGAANVVIMLIGNK PA
1
186-198 (13) HVLFEDACTLAEK PA
1
199-210 (12) YGLLAVLETSAK PA
1
214-224 (11) NIEEVFVLMAK PA
1
230-259 (30) NSLHLYGESALNGLPLDSSPVLMAQGPSEK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center