Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A4D1U4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-12 (12) MVEQGDAAPLLR PA
0
13-34 (22) WAEGPAVSLPQAPQPQAGGWGR PA
0
35-48 (14) GGGGGARPAAEPPR PA
0
51-66 (16) EPEEPAAPEVLLQPGR PA
0
67-88 (22) LELGDVEEDQVVAVFVVTFDPR PA
0
89-109 (21) SGNMVEWCLPQDIDLEGVEFK PA
0
110-117 (8) SMASGSHK PA
0
118-126 (9) IQSDFIYFR PA
0
128-147 (20) GPFFGLACFANMPVESELER PA
0
153-166 (14) SVGILSPSYTLLYR PA
0
167-176 (10) YMHFLENQVR PA
0
177-195 (19) HQLEMPGHYSHLAAFYEDK PA
0
197-205 (9) GVLHAGPGR PA
0
206-220 (15) GSSLPPVYWLPSIHR PA
0
228-240 (13) ITHPAGCMSQFIK PA
0
241-251 (11) FFGEQILILWK PA
0
259-273 (15) ILIFSPPPVGVVCYR PA
0
274-322 (49) VYCCCCLANVSLPGIGGTIPESKPFFYVNVADIESLEVEVSYVACTTEK PA
0
329-341 (13) ELYDVYVDNQNVK PA
0
342-352 (11) THHDHLQPLLK PA
0
369-399 (31) QMLLYSQEVEEDYNPCEEDLFVLFFLEQNNR PA
0
400-413 (14) IFQTLLEVSASQDK PA
0
414-421 (8) TLTAEHAR PA
0
422-431 (10) GMGLDPQGDR PA
0
432-455 (24) SFLLDLLEAYGIDVMLVIDNPCCP PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center