Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A4D2G3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MGGNQTSITEFLLLGFPIGPR PA
0
22-53 (32) IQMLLFGLFSLFYIFILLGNGTILGLISLDSR PA
0
54-121 (68) LHTPMYFFLSHLAVVDIACACSTVPQMLVNLLHPAKPISFAGCMTQMFLFLSFAHTECLLLVVMSYDR PA
0
122-130 (9) YVAICHPLR PA
24
131-138 (8) YSTIMTWK PA
0
139-172 (34) VCITLALTSWILGVLLALVHLVLLLPLSFCGPQK PA
0
173-185 (13) LNHFFCEIMAVLK PA
0
186-226 (41) LACADTHINEVMVLAGAVSVLVGAFFSTVISYVHILCAILK PA
0
227-235 (9) IQSGEGCQK PA
0
236-267 (32) AFSICSSHLCVVGLFYGTAIIMYVEPQYESPK PA
0
272-292 (21) YLLLFHSLFNPMLNPLIYSLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center