Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A5PL33-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-30 (28) ENYETLVSVGTAELLPLSAFLSPSEPGR PA
2
31-56 (26) AVGGGSHADEGQEPAGCGDPQGGQPR PA
2
57-69 (13) HSLHLTALVQLVK PA
2
70-80 (11) EIPEFLFGEVK PA
2
81-91 (11) GAMDSPESESR PA
2
92-99 (8) GASLDGER PA
2
100-108 (9) ASPEAAAAR PA
1
115-156 (42) GLLSCLPDGPTSQPHLATTPTDSSCSSGPTGDGVQGSPLPIK PA
2
157-165 (9) TADKPWPTR PA
2
167-185 (19) EGPGALGGEPSPPTHSPSR PA
2
195-216 (22) GTSEAGISPGNSPLQGLINCLK PA
2
217-224 (8) EILVPGPR PA
2
225-243 (19) HPETSPSFLPPLPSLGTSR PA
2
247-259 (13) ADLGPGSPPWAVK PA
2
260-277 (18) TEAVSGDCPLQGLLHCLK PA
2
278-285 (8) ELPEAQDR PA
2
286-295 (10) HPSPSGVGNR PA
2
297-305 (9) LQENPGAWK PA
2
307-332 (26) GSGGPGYLLTPPPHPDLGAGGLLSVK PA
2
333-351 (19) MENSWVQSPPGPASCQPGR PA
2
352-363 (12) QPLSPSATGDTR PA
2
364-392 (29) GVPQPSWGPEAQAASASSSPLEALEACLK PA
2
393-419 (27) GIPPNGSSPSQLPPTSCSQNPQPGDSR PA
2
420-429 (10) SQKPELQPHR PA
2
430-437 (8) SHSEEATR PA
2
438-450 (13) EPVLPLGLQSCVR PA
2
451-460 (10) DGPSRPLAPR PA
2
461-491 (31) GTPTSFSSSSSTDWDLDFGSPVGNQGQHPGK PA
2
492-508 (17) GSPPGSSPLQGLENCLK PA
2
509-527 (19) EIPVPVLRPAWPCSSAADR PA
2
546-553 (8) AEACESAR PA
1
565-585 (21) SLHLVSPQVFTSSCVPACHQR PA
1
589-599 (11) DPGATRPGVWR PA
1
600-620 (21) WLPEGSAPKPSPLHCLESALR PA
1
621-629 (9) GILPVRPLR PA
2
630-670 (41) FACVGGPSPSPSPGSSSSFSGSEGEDPRPEPDLWKPLPQER PA
2
673-703 (31) LPSCKPPVPLSPCPGGTPAGSSGGSPGEDPR PA
2
709-729 (21) YCSGLGAGTAQDPCPVSQLEK PA
2
739-748 (10) GLELGHGRPR PA
2
757-813 (57) LLPQGPPELPSESPPPELPPPEAAPPVLPASSLQPPCHCGKPLQQELHSLGAALAEK PA
2
817-832 (16) LATALAGLAQEVATMR PA
2
841-859 (19) RPQGPGPMGQASWMWTLPR PA
2
863-870 (8) WAHGPGHR PA
2
879-886 (8) GPTRPKPK PA
2
897-905 (9) AGDLQGLSR PA
2
911-1000 (90) ARPLPPDAPPAEPPGLHCSSSQQLLSSTPSCHAAPPAHPLLAHTGGHQSPLPPLVPAALPLQGASPPAASADADVPTSGV
APDGIPERPK PA
2
1001-1011 (11) EPSSLLGGVQR PA
2
1012-1023 (12) ALQEELWGGEHR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center