Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A5YKK6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MNLDSLSLALSQISYLVDNLTK PA
3
27-38 (12) ASQQEIQHIVNR PA
3
50-62 (13) CLFSHVDFSGDGK PA
3
67-103 (37) DFHQTQFLIQECALLITKPNFISTLSYAIDNPLHYQK PA
3
104-117 (14) SLKPAPHLFAQLSK PA
3
124-142 (19) VQEVIFGLALLNSSSSDLR PA
3
143-150 (8) GFAAQFIK PA
3
159-193 (35) SYIDADVSGNQEGGFQDIAIEVLHLLLSHLLFGQK PA
3
194-208 (15) GAFGVGQEQIDAFLK PA
3
219-231 (13) CPVVLAPLLYPEK PA
3
239-248 (10) ILPDSGGVAK PA
3
249-274 (26) TMMESSLADFMQEVGYGFCASIEECR PA
3
275-283 (9) NIIVQFGVR PA
3
284-292 (9) EVTAAQVAR PA
3
300-325 (26) THSGLTDGIPLQSISAPGSGIWSDGK PA
3
328-346 (19) SDGAQAHTWNVEVLIDVLK PA
3
347-355 (9) ELNPSLNFK PA
3
356-369 (14) EVTYELDHPGFQIR PA
3
373-383 (11) GLHNVVYGIQR PA
3
384-400 (17) GLGMEVFPVDLIYRPWK PA
3
401-435 (35) HAEGQLSFIQHSLINPEIFCFADYPCHTVATDILK PA
3
436-443 (8) APPEDDNR PA
3
450-459 (10) SLDLIESLLR PA
3
460-470 (11) LAEVGQYEQVK PA
3
471-478 (8) QLFSFPIK PA
3
479-499 (21) HCPDMLVLALLQINTSWHTLR PA
3
500-535 (36) HELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIR PA
3
536-548 (13) QLIMHAMAEWYMR PA
3
549-556 (8) GEQYDQAK PA
3
560-568 (9) ILDVAQDLK PA
3
569-591 (23) ALSMLLNGTPFAFVIDLAALASR PA
3
607-621 (15) EHGEPFIQACMTFLK PA
3
624-635 (12) CPSILGGLAPEK PA
3
640-683 (44) SAQLPPETLATMLACLQACAGSVSQELSETILTMVANCSNVMNK PA
3
686-694 (9) QPPPGVMPK PA
3
695-752 (58) GRPPSASSLDAISPVQIDPLAGMTSLSIGGSAAPHTQSMQGFPPNLGSAFSTPQSPAK PA
3
753-807 (55) AFPPLSTPNQTTAFSGIGGLSSQLPVGGLGTGSLTGIGTGALGLPAVNNDPFVQR PA
3
809-823 (15) LGTSGLNQPTFQQSK PA
1
824-842 (19) MKPSDLSQVWPEANQHFSK PA
1
843-854 (12) EIDDEANSYFQR PA
3
855-875 (21) IYNHPPHPTMSVDEVLEMLQR PA
3
886-893 (8) EVFNCMLR PA
3
901-908 (8) FFPQYPDK PA
3
909-923 (15) ELHITACLFGGIIEK PA
3
924-936 (13) GLVTYMALGLALR PA
3
950-960 (11) MYYFGIAALDR PA
3
967-999 (33) DYPQYCQHLASISHFMQFPHHLQEYIEYGQQSR PA
3
1005-1029 (25) MQGSITTPGSIALAQAQAQAQVPAK PA
3
1030-1050 (21) APLAGQVSTMVTTSTTTTVAK PA
3
1051-1063 (13) TVTVTRPTGVSFK PA
3
1065-1087 (23) DVPPSINTTNIDTLLVATDQTER PA
3
1088-1098 (11) IVEPPENIQEK PA
3
1099-1114 (16) IAFIFNNLSQSNMTQK PA
3
1124-1137 (14) EEFMPWVSQYLVMK PA
3
1139-1157 (19) VSIEPNFHSLYSNFLDTLK PA
3
1164-1171 (8) MVLNETYR PA
3
1182-1189 (8) AAANFSDR PA
3
1194-1206 (13) NLGHWLGMITLAK PA
3
1207-1218 (12) NKPILHTDLDVK PA
3
1219-1227 (9) SLLLEAYVK PA
3
1228-1241 (14) GQQELLYVVPFVAK PA
3
1249-1276 (28) SVVFRPPNPWTMAIMNVLAELHQEHDLK PA
3
1281-1288 (8) FEIEVLCK PA
3
1289-1304 (16) NLALDINELKPGNLLK PA
3
1311-1320 (10) NLDEQLSAPK PA
3
1325-1390 (66) QPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVYSLAGLAPHITLNPTIPLFQAHPQLK PA
3
1400-1411 (12) AVQELVHPVVDR PA
3
1415-1425 (11) IAMTTCEQIVR PA
3
1427-1436 (10) DFALDSEESR PA
3
1439-1446 (8) IAAHHMMR PA
3
1447-1458 (12) NLTAGMAMITCR PA
3
1459-1470 (12) EPLLMSISTNLK PA
3
1471-1478 (8) NSFASALR PA
3
1486-1509 (24) EMMDQAAAQLAQDNCELACCFIQK PA
2
1523-1530 (8) LATEFELR PA
2
1540-1552 (13) YCDPVVLTYQAER PA
2
1568-1577 (10) QLAVYEEFAR PA
2
1578-1600 (23) NVPGFLPTNDLSQPTGFLAQPMK PA
2
1601-1614 (14) QAWATDDVAQIYDK PA
2
1615-1640 (26) CITELEQHLHAIPPTLAMNPQAQALR PA
2
1641-1650 (10) SLLEVVVLSR PA
2
1654-1664 (11) DAIAALGLLQK PA
2
1665-1683 (19) AVEGLLDATSGADADLLLR PA
2
1686-1693 (8) ECHLLVLK PA
2
1700-1708 (9) AYGSPWCNK PA
2
1723-1733 (11) YNVEAVELLIR PA
2
1734-1767 (34) NHLVNMQQYDLHLAQSMENGLNYMAVAFAMQLVK PA
2
1775-1793 (19) SVAHVTEADLFHTIETLMR PA
2
1800-1814 (15) GNAPEGLPQLMEVVR PA
2
1815-1823 (9) SNYEAMIDR PA
2
1824-1849 (26) AHGGPNFMMHSGISQASEYDDPPGLR PA
2
1858-1870 (13) EWVNLYHSAAAGR PA
2
1875-1890 (16) AFSAFVGQMHQQGILK PA
2
1901-1912 (12) LCTEMCVEISYR PA
2
1913-1929 (17) AQAEQQHNPAANPTMIR PA
2
1932-1941 (10) CYHNLDAFVR PA
2
1949-1959 (11) HSGEATNTVTK PA
2
1966-1981 (16) VLGIVVGVLLQDHDVR PA
2
1982-1992 (11) QSEFQQLPYHR PA
2
1993-2030 (38) IFIMLLLELNAPEHVLETINFQTLTAFCNTFHILRPTK PA
2
2031-2045 (15) APGFVYAWLELISHR PA
2
2051-2059 (9) MLAHTPQQK PA
2
2060-2073 (14) GWPMYAQLLIDLFK PA
2
2081-2093 (13) NVELTKPMQILYK PA
2
2098-2129 (32) VLLVLLHDFPEFLCDYHYGFCDVIPPNCIQLR PA
2
2130-2138 (9) NLILSAFPR PA
2
2142-2151 (10) LPDPFTPNLK PA
2
2152-2163 (12) VDMLSEINIAPR PA
1
2164-2177 (14) ILTNFTGVMPPQFK PA
1
2188-2197 (10) SPVTFLSDLR PA
1
2198-2209 (12) SNLQVSNEPGNR PA
1
2210-2233 (24) YNLQLINALVLYVGTQAIAHIHNK PA
1
2234-2263 (30) GSTPSMSTITHSAHMDIFQNLAVDLDTEGR PA
1
2264-2275 (12) YLFLNAIANQLR PA
1
2276-2306 (31) YPNSHTHYFSCTMLYLFAEANTEAIQEQITR PA
1
2312-2331 (20) LIVNRPHPWGLLITFIELIK PA
1
2337-2351 (15) FWNHEFVHCAPEIEK PA
1
2352-2364 (13) LFQSVAQCCMGQK PA
1
2365-2376 (12) QAQQVMEGTGAS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center