Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A5YKK6-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-22 (22) MNLDSLSLALSQISYLVDNLTK PA
3
27-38 (12) ASQQEIQHIVNR PA
3
50-62 (13) CLFSHVDFSGDGK PA
3
67-103 (37) DFHQTQFLIQECALLITKPNFISTLSYAIDNPLHYQK PA
3
104-117 (14) SLKPAPHLFAQLSK PA
3
124-142 (19) VQEVIFGLALLNSSSSDLR PA
3
143-150 (8) GFAAQFIK PA
3
159-193 (35) SYIDADVSGNQEGGFQDIAIEVLHLLLSHLLFGQK PA
3
194-208 (15) GAFGVGQEQIDAFLK PA
3
219-231 (13) CPVVLAPLLYPEK PA
3
239-248 (10) ILPDSGGVAK PA
3
249-274 (26) TMMESSLADFMQEVGYGFCASIEECR PA
3
275-283 (9) NIIVQFGVR PA
3
284-292 (9) EVTAAQVAR PA
3
300-325 (26) THSGLTDGIPLQSISAPGSGIWSDGK PA
3
328-346 (19) SDGAQAHTWNVEVLIDVLK PA
3
347-355 (9) ELNPSLNFK PA
3
356-369 (14) EVTYELDHPGFQIR PA
3
373-383 (11) GLHNVVYGIQR PA
3
384-400 (17) GLGMEVFPVDLIYRPWK PA
3
401-435 (35) HAEGQLSFIQHSLINPEIFCFADYPCHTVATDILK PA
3
436-443 (8) APPEDDNR PA
3
450-459 (10) SLDLIESLLR PA
3
460-470 (11) LAEVGQYEQVK PA
3
471-478 (8) QLFSFPIK PA
3
479-499 (21) HCPDMLVLALLQINTSWHTLR PA
3
500-535 (36) HELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIR PA
3
536-548 (13) QLIMHAMAEWYMR PA
3
549-556 (8) GEQYDQAK PA
3
560-568 (9) ILDVAQDLK PA
3
569-591 (23) ALSMLLNGTPFAFVIDLAALASR PA
3
607-621 (15) EHGEPFIQACMTFLK PA
3
624-635 (12) CPSILGGLAPEK PA
3
640-683 (44) SAQLPPETLATMLACLQACAGSVSQELSETILTMVANCSNVMNK PA
3
686-694 (9) QPPPGVMPK PA
3
695-752 (58) GRPPSASSLDAISPVQIDPLAGMTSLSIGGSAAPHTQSMQGFPPNLGSAFSTPQSPAK PA
3
753-807 (55) AFPPLSTPNQTTAFSGIGGLSSQLPVGGLGTGSLTGIGTGALGLPAVNNDPFVQR PA
3
809-837 (29) LGTSGLNQPTFQQTDLSQVWPEANQHFSK PA
1
838-849 (12) EIDDEANSYFQR PA
3
850-870 (21) IYNHPPHPTMSVDEVLEMLQR PA
3
881-888 (8) EVFNCMLR PA
3
896-903 (8) FFPQYPDK PA
3
904-918 (15) ELHITACLFGGIIEK PA
3
919-931 (13) GLVTYMALGLALR PA
3
945-955 (11) MYYFGIAALDR PA
3
962-994 (33) DYPQYCQHLASISHFMQFPHHLQEYIEYGQQSR PA
3
1000-1024 (25) MQGSITTPGSIALAQAQAQAQVPAK PA
3
1025-1045 (21) APLAGQVSTMVTTSTTTTVAK PA
3
1046-1058 (13) TVTVTRPTGVSFK PA
3
1060-1082 (23) DVPPSINTTNIDTLLVATDQTER PA
3
1083-1093 (11) IVEPPENIQEK PA
3
1094-1109 (16) IAFIFNNLSQSNMTQK PA
3
1119-1132 (14) EEFMPWVSQYLVMK PA
3
1134-1152 (19) VSIEPNFHSLYSNFLDTLK PA
3
1159-1166 (8) MVLNETYR PA
3
1177-1184 (8) AAANFSDR PA
3
1189-1201 (13) NLGHWLGMITLAK PA
3
1202-1213 (12) NKPILHTDLDVK PA
3
1214-1222 (9) SLLLEAYVK PA
3
1223-1236 (14) GQQELLYVVPFVAK PA
3
1244-1271 (28) SVVFRPPNPWTMAIMNVLAELHQEHDLK PA
3
1276-1283 (8) FEIEVLCK PA
3
1284-1299 (16) NLALDINELKPGNLLK PA
3
1306-1315 (10) NLDEQLSAPK PA
3
1320-1385 (66) QPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVYSLAGLAPHITLNPTIPLFQAHPQLK PA
3
1395-1406 (12) AVQELVHPVVDR PA
3
1410-1420 (11) IAMTTCEQIVR PA
3
1422-1431 (10) DFALDSEESR PA
3
1434-1441 (8) IAAHHMMR PA
3
1442-1453 (12) NLTAGMAMITCR PA
3
1454-1465 (12) EPLLMSISTNLK PA
3
1466-1473 (8) NSFASALR PA
3
1481-1504 (24) EMMDQAAAQLAQDNCELACCFIQK PA
2
1518-1525 (8) LATEFELR PA
2
1535-1547 (13) YCDPVVLTYQAER PA
2
1563-1572 (10) QLAVYEEFAR PA
2
1573-1595 (23) NVPGFLPTNDLSQPTGFLAQPMK PA
2
1596-1609 (14) QAWATDDVAQIYDK PA
2
1610-1635 (26) CITELEQHLHAIPPTLAMNPQAQALR PA
2
1636-1645 (10) SLLEVVVLSR PA
2
1649-1659 (11) DAIAALGLLQK PA
2
1660-1678 (19) AVEGLLDATSGADADLLLR PA
2
1681-1688 (8) ECHLLVLK PA
2
1695-1703 (9) AYGSPWCNK PA
2
1718-1728 (11) YNVEAVELLIR PA
2
1729-1762 (34) NHLVNMQQYDLHLAQSMENGLNYMAVAFAMQLVK PA
2
1770-1788 (19) SVAHVTEADLFHTIETLMR PA
2
1795-1809 (15) GNAPEGLPQLMEVVR PA
2
1810-1818 (9) SNYEAMIDR PA
2
1819-1844 (26) AHGGPNFMMHSGISQASEYDDPPGLR PA
2
1853-1865 (13) EWVNLYHSAAAGR PA
2
1870-1885 (16) AFSAFVGQMHQQGILK PA
2
1896-1907 (12) LCTEMCVEISYR PA
2
1908-1924 (17) AQAEQQHNPAANPTMIR PA
2
1927-1936 (10) CYHNLDAFVR PA
2
1944-1954 (11) HSGEATNTVTK PA
2
1961-1976 (16) VLGIVVGVLLQDHDVR PA
2
1977-1987 (11) QSEFQQLPYHR PA
2
1988-2025 (38) IFIMLLLELNAPEHVLETINFQTLTAFCNTFHILRPTK PA
2
2026-2040 (15) APGFVYAWLELISHR PA
2
2046-2054 (9) MLAHTPQQK PA
2
2055-2068 (14) GWPMYAQLLIDLFK PA
2
2076-2088 (13) NVELTKPMQILYK PA
2
2093-2124 (32) VLLVLLHDFPEFLCDYHYGFCDVIPPNCIQLR PA
2
2125-2133 (9) NLILSAFPR PA
2
2137-2146 (10) LPDPFTPNLK PA
2
2147-2158 (12) VDMLSEINIAPR PA
1
2159-2172 (14) ILTNFTGVMPPQFK PA
1
2183-2192 (10) SPVTFLSDLR PA
1
2193-2204 (12) SNLQVSNEPGNR PA
1
2205-2228 (24) YNLQLINALVLYVGTQAIAHIHNK PA
1
2229-2258 (30) GSTPSMSTITHSAHMDIFQNLAVDLDTEGR PA
1
2259-2270 (12) YLFLNAIANQLR PA
1
2271-2301 (31) YPNSHTHYFSCTMLYLFAEANTEAIQEQITR PA
1
2307-2326 (20) LIVNRPHPWGLLITFIELIK PA
1
2332-2346 (15) FWNHEFVHCAPEIEK PA
1
2347-2359 (13) LFQSVAQCCMGQK PA
1
2360-2371 (12) QAQQVMEGTGAS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center