Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6H8M9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-72 (67) LLVFLFAPVVSDLCSLPCFINVSESQGPGTVLQFLSFNCSSYTPTPTLELLNVQPPTTFFNPPSLAR PA
1
73-80 (8) WQGTYVGK PA
1
81-98 (18) LTLSSSAQLDALMVNHYK PA
1
103-120 (18) FTCGNHVMEGSLSVDVQR PA
1
121-150 (30) DLSHIQCAGQFASPAGEMIQVPETVTPGAR PA
0
151-202 (52) LYTLLLPGLELHGAQMSIISAQDLPHFPGPFSINEQGWLQAPSQGLLGQAQK PA
0
203-215 (13) VFQLQISVSFGQR PA
0
216-225 (10) QSCQGMVIVK PA
0
226-261 (36) VLPVPSSQVSFLEQAQNITIPENLAPGSEVVQVQAR PA
0
267-282 (16) YEILSPVPSPLFSIGR PA
0
289-297 (9) TTTPLELAR PA
0
298-305 (8) TSGTAVSR PA
0
310-321 (12) AFEQGQLWASAK PA
0
322-337 (16) LNLTMNVQLVNLWPPR PA
0
338-375 (38) CLPALLVSQIPETAPVGTVLNTLTCEDPDSVGATLDYK PA
0
380-392 (13) SSSNPASLCLYDR PA
0
393-448 (56) VLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPR PA
0
452-492 (41) VQEDAAPHTLLGSVVGTDMDYPHDNIEYYTSGGPTTFAVDR PA
0
493-509 (17) LSGEVHLLGPLDYEQQR PA
0
513-565 (53) LTVLVIDHGQDQNPNHHLSGSCTITIEVEDVNDHAPECEPPFQELTIYAPLGR PA
0
572-582 (11) MSCQIPQEPQR PA
0
583-597 (15) LIYSYSIVGGNSQNR PA
0
598-621 (24) FILQGAILVHSDLVLGPFWPEQPR PA
0
622-652 (31) TYELLICVADAGPSTPHLSTTATIIVHLVPR PA
0
654-663 (10) ASTVATSTHR PA
0
664-709 (46) TTVPSTMTPMLVTDTEAFWQPQPWFVVVLTATGALLLLALGWLLGR PA
0
710-748 (39) LLQGLAQLLQAPSKPAQALLLNSIQGTEGSIEGFLEAPK PA
0
749-766 (18) MEMSQAPSSVMSLHFDGR PA
0
775-785 (11) DYLFNTHTGAR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center