Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6H8M9-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-72 (67) LLVFLFAPVVSDLCSLPCFINVSESQGPGTVLQFLSFNCSSYTPTPTLELLNVQPPTTFFNPPSLAR PA
1
73-80 (8) WQGTYVGK PA
1
81-98 (18) LTLSSSAQLDALMVNHYK PA
1
103-120 (18) FTCGNHVMEGSLSVDVQR PA
1
121-138 (18) DLSHIQCAGQFASPGEAR PA
0
152-168 (17) SSLTSTLASWGNDSGAR PA
0
169-185 (17) DSHTWGSAVHSAPPRPR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center