Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NDL8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-40 (37) HTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGK PA
0
41-54 (14) LTIIALTMLDPHLK PA
0
55-78 (24) TPMYFFLQNLSFLEISFTATCVPR PA
0
79-88 (10) FLYSISTGNK PA
0
89-120 (32) IITYNACVIQLFFADLFGVTEFFLLATMSYDR PA
0
121-137 (17) YVAICKPLHYMAIMSNK PA
0
141-184 (44) TMVICCWMAALMIILPPLSLGFHLEFCDSNVINHFGCDALPILK PA
0
185-221 (37) IPCSDTSLIEQMVVASAVLTFIITLVCVVLSYTYIIR PA
0
235-263 (29) AFSTCSSHITVVSITYGSCIFIYIKPSAK PA
0
271-291 (21) GVSVLISSISPMLNSFIYTLR PA
0
297-304 (8) QAFHDSLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center