Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NES4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-20 (14) AELFLVVNICLIQK PA
0
26-50 (25) ELEEEMTEAITEAAVDSSEEVSEER PA
0
51-80 (30) DDLGPLELHDSGTFQQVVNLLDIIDSESAK PA
0
81-91 (11) TDTTGAGLDMR PA
0
93-102 (10) TLASVIIMEK PA
0
103-116 (14) ATTEPSVVINTLIR PA
0
117-127 (11) CLQVPEISTQR PA
0
129-152 (24) VNIYNILQDIIQQEGELEEQCVQR PA
0
163-172 (10) EIPEMEGYMK PA
0
173-185 (13) AEVASDTLVALSR PA
0
186-215 (30) NHFSLVMYELQHHLKPLNLTDEFVIITLAK PA
0
216-240 (25) LANGNVFEFMPYMGITLATIFTMLR PA
0
249-267 (19) QAICSAMETFCETVQFYLK PA
0
268-285 (18) HLEESVYPVMTEEEFALK PA
0
292-299 (8) YFVTVWLR PA
0
312-327 (16) SLKPMLGLLLPNDDLR PA
0
328-355 (28) EQVYDYIPLLLAEYQGSLEALFVTQVLR PA
0
356-387 (32) QILGLSVTTNTPVPQMQLHTIFTELHVQVCNK PA
0
388-411 (24) APAQHQYSSQNLMEMVHCFVALAR PA
0
420-429 (10) FFFSQMETNK PA
0
434-441 (8) VGTLNLIR PA
0
442-450 (9) AIVSADEPR PA
0
476-493 (18) MAILHIIGQLALCGYQER PA
0
501-512 (12) YLSVQLTLSTYK PA
0
540-555 (16) IITSSVSGMTTEFWVR PA
0
556-596 (41) LLCYIMETDYVEALTPICISLTNLAEHQLHGQDVDVSVAGK PA
0
599-607 (9) QVDLPAPQK PA
0
612-621 (10) LLVLMSSPYK PA
0
626-634 (9) GIAMLNLLR PA
0
635-657 (23) TLSQSIAPSMADMWELEIALLVR PA
0
658-670 (13) YLEEHTEFTWDQK PA
0
699-714 (16) ELNNQIASFDSPSLEK PA
0
720-733 (14) ALGFTLATGLEASK PA
0
734-744 (11) VEVLLLELLYK PA
0
745-765 (21) TDYSNDFDSEGVIMCFGLCAR PA
0
770-781 (12) TVLNVLHDFEER PA
0
782-795 (14) IQESEQSWQISAWR PA
0
807-836 (30) SALMVMYSCVASYCHPQLLLNLVDSPITAK PA
0
837-851 (15) IIHHYVSSCQDICLK PA
0
870-879 (10) DLEDFHFAQK PA
0
880-891 (12) TTLTSIIVAVIK PA
0
892-903 (12) AEPTDNLVSPVR PA
0
904-915 (12) ALAMEALSHLSK PA
0
916-950 (35) LKPFYSTEENSELMDISIHSVISLQLPGEDNESIK PA
0
951-970 (20) TLYANALSSLEQLMESLLQR PA
0
976-986 (11) GLQEMVQLLEK PA
0
999-1008 (10) AVSLHLYLMR PA
0
1009-1021 (13) IYVHSTAVCIHLK PA
0
1022-1042 (21) LGQFGTMVGLIAPCTCDAHQR PA
0
1045-1070 (26) MASMNVLSSLLDLHASQTCSLWGPSK PA
0
1079-1088 (10) GDLQSTDVEK PA
0
1099-1115 (17) VVCMEFSCDEVVSLIQK PA
0
1116-1129 (14) LCENTGAMNLQHDK PA
0
1130-1142 (13) ASVTWIAFFLQMR PA
0
1150-1170 (21) VAEILSAILVHLPVVDHPEVR PA
0
1172-1194 (23) LLIDGILLLAHHHQETILTSLLR PA
0
1195-1218 (24) QPLPMESHLAEVWLAVSENVPFAR PA
0
1219-1227 (9) TMLHSLMGR PA
0
1247-1265 (19) LAAVDPLMTLCTIHLLIQK PA
0
1272-1301 (30) LPDFLPDLIYTLLLQLGSSHRPEAAPPVLK PA
0
1305-1319 (15) LVHTTPLPEEMNLQR PA
0
1334-1365 (32) SQHLAHTLDEQAVWDLLQDGGTFLEGVSLLAR PA
0
1366-1375 (10) LCMQHVEGHR PA
0
1385-1394 (10) GMDSEVLSCR PA
0
1395-1414 (20) ISSTAVCVEFMSGPVLYQEK PA
0
1415-1425 (11) LLKPAALLLEK PA
0
1426-1436 (11) GADQEEDEALR PA
0
1442-1452 (11) ALGNMALGAPK PA
0
1471-1487 (17) EPVSNSVTAEGMEALTK PA
0
1494-1509 (16) EGDVGSSFDAMSEQCR PA
0
1510-1520 (11) IFFDNESELLR PA
0
1549-1582 (34) AWIPLMLHSQDPCSNAAQACMATMFQCVHFWGWK PA
0
1583-1598 (16) SLEHPSGPSDTATDDK PA
0
1599-1612 (14) MTVFQTTMCSILTR PA
0
1621-1630 (10) FLLETMAYVK PA
0
1638-1649 (12) IAACNLAGIIMK PA
0
1650-1657 (8) QMSTHYLK PA
0
1666-1680 (15) NSLQELQLDPDPGVR PA
0
1682-1706 (25) AALETLTVLDSCSQHGFLASPQGMS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center