Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NFI3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MAALHTTPDSPAAQLER PA
0
18-37 (20) AEDGSECDPDQEEEEEEEEK PA
0
38-87 (50) GEEVQEVEEEEEEIVVEEEEEGVAEVVQDAQVEAVAEVEVEADVEEEDVK PA
0
88-103 (16) EVLAEEECPALGTQER PA
0
131-174 (44) DEDLEEEEEEEEDEDEDDLLTAGCQELVTFEDVAVYFSLEEWER PA
0
181-209 (29) GLYQEVMQENYGILVSLGYPIPKPDLIFR PA
0
210-320 (111) LEQGEEPWVPDSPRPEEGDIVTGVYTGAWFWTDDIEDHEEEDDEDFLAEVAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGPDPGGLGVLADGSEAKPFLPGR PA
0
321-352 (32) EPGANLLSPWAFPAAVAPPAGRPETTCDVCGK PA
0
366-380 (15) YHAAVKPFGCEECGK PA
0
386-393 (8) SHLAIHQR PA
0
394-408 (15) THTGEKPFPCPDCGK PA
0
422-430 (9) IHTGERPYR PA
0
431-440 (10) CAFCGAGFGR PA
0
442-449 (8) SYLVTHQR PA
0
450-464 (15) THTGERPYPCSHCGR PA
0
465-474 (10) SFSQSSALAR PA
0
475-495 (21) HQAVHTADRPHCCPDCGQAFR PA
0
506-518 (13) GGGCAEAGGDGPR PA
0
520-556 (37) EPGETAAAAGPEDTDPGPEGSEVGEADGEAEAAAEER PA
0
557-569 (13) EEAAVAAPTPSGK PA
0
578-605 (28) FLELGNGLGEGEGPSSHPLGFHFPVHPK PA
0
606-622 (17) SWLHPDSFPILGLPDFR PA
0
625-666 (42) LPVDGRPLPAPLGGPLSLVEGTGLACDPFGGGGAAGGGGGLR PA
0
667-698 (32) AFGPAIGGLLAEPAPAALAEEESPWICSDCGK PA
0
712-720 (9) YHAGERPHR PA
0
727-736 (10) SFVYGSHLAR PA
0
740-755 (16) THTGERPFPCPECGAR PA
0
759-767 (9) GSHLAAHVR PA
0
768-786 (19) GHTGEKPFVCGVCGAGFSR PA
0
788-795 (8) AHLTAHGR PA
0
796-810 (15) AHTGERPYACGECGR PA
0
812-820 (9) FGQSAALTR PA
0
821-832 (12) HQWAHAEEKPHR PA
0
839-847 (9) GFGHSSDFK PA
0
852-860 (9) THTGEKPFR PA
7
880-894 (15) GHTGERPFPCPECGK PA
0
900-907 (8) SVLVTHQR PA
0
908-922 (15) THTGERPYACANCGR PA
0
924-935 (12) FSQSSHLLTHMK PA
0
939-961 (23) GATAAPGSGSAPAPAPKPEAAAK PA
0
962-971 (10) GPSSAGPGER PA
0
972-1000 (29) GSALLEFAGGTSFGSEHQAAFAGPSGAYR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center