Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NFQ2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-23 (23) MATIAAAAFEALMDGVTCWDVPR PA
1
24-45 (22) GPIPSELLLIGEAAFPVMVNDK PA
1
46-57 (12) GQVLIAASSYGR PA
1
60-144 (85) LVVVSHEGYLSHTGLAPFLLNAVSWLCPCPGAPVGVHPSLAPLVNILQDAGLEAQVKPEPGEPLGVYCINAYNDTLTATL
IQFVK PA
1
145-166 (22) HGGGLLIGGQAWYWASQHGPDK PA
1
176-191 (16) VTSVAGVYFTDTYGDR PA
1
215-230 (16) QDQQQLLEGISELDIR PA
2
231-265 (35) TGGVPSQLLVHGALAFPLGLDASLNCFLAAAHYGR PA
2
268-281 (14) VVLAAHECLLCAPK PA
2
282-291 (10) MGPFLLNAVR PA
2
301-308 (8) VGVNTNLK PA
2
309-337 (29) DLCPLLSEHGLQCSLEPHLNSDLCVYCCK PA
2
346-398 (53) QLQEFVAEGGGLLIGGQAWWWASQNPGHCPLAGFPGNIILNCFGLSILPQTLK PA
2
399-410 (12) AGCFPVPTPEMR PA
2
417-434 (18) ALSQFQAILNHENGNLEK PA
2
442-463 (22) VDGAAFLQIPAEGVPAYISLHR PA
2
471-479 (9) GSGLPAVSR PA
2
480-526 (47) ENPVASDSYEAAVLSLATGLAHSGTDCSQLAQGLGTWTCSSSLYPSK PA
2
527-571 (45) HPITVEINGINPGNNDCWVSTGLYLLEGQNAEVSLSEAAASAGLR PA
1
572-583 (12) VQIGCHTDDLTK PA
2
590-601 (12) APVVTHQCWMDR PA
2
605-620 (16) SVSCLWGGLLYVIVPK PA
2
621-632 (12) GSQLGPVPVTIR PA
2
633-641 (9) GAVPAPYYK PA
2
653-682 (30) QMQENLAPWGELATDNIILTVPTTNLQALK PA
2
690-700 (11) LWDEMMQAVAR PA
2
701-709 (9) LAAEPFPFR PA
2
714-739 (26) IVADVQISAGWMHSGYPIMCHLESVK PA
2
740-748 (9) EIINEMDMR PA
2
751-765 (15) GVWGPIHELGHNQQR PA
2
766-795 (30) HGWEFPPHTTEATCNLWSVYVHETVLGIPR PA
2
796-807 (12) AQAHEALSPPER PA
2
818-860 (43) GAPLCDWNVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPK PA
1
880-894 (15) NLVPFFEAWGWPIQK PA
1
895-916 (22) EVADSLASLPEWQENPMQVYLR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center