Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NFQ2-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
23-44 (22) EENGNSSSSPHHQLQSHASGPR PA
0
51-66 (16) QDQQQLLEGISELDIR PA
2
67-101 (35) TGGVPSQLLVHGALAFPLGLDASLNCFLAAAHYGR PA
2
104-117 (14) VVLAAHECLLCAPK PA
2
118-127 (10) MGPFLLNAVR PA
2
137-144 (8) VGVNTNLK PA
2
145-173 (29) DLCPLLSEHGLQCSLEPHLNSDLCVYCCK PA
2
182-234 (53) QLQEFVAEGGGLLIGGQAWWWASQNPGHCPLAGFPGNIILNCFGLSILPQTLK PA
2
235-246 (12) AGCFPVPTPEMR PA
2
253-270 (18) ALSQFQAILNHENGNLEK PA
2
278-299 (22) VDGAAFLQIPAEGVPAYISLHR PA
2
307-315 (9) GSGLPAVSR PA
2
316-362 (47) ENPVASDSYEAAVLSLATGLAHSGTDCSQLAQGLGTWTCSSSLYPSK PA
2
363-387 (25) HPITVEINGINPESHSVIQVGMQWR PA
0
388-416 (29) DLSSCNLHLLGLSNSSLSASCVAGTTGTR PA
0
417-429 (13) HHAWLIFVFLVER PA
0
435-467 (33) GNNDCWVSTGLYLLEGQNAEVSLSEAAASAGLR PA
0
468-479 (12) VQIGCHTDDLTK PA
2
486-497 (12) APVVTHQCWMDR PA
2
501-516 (16) SVSCLWGGLLYVIVPK PA
2
517-528 (12) GSQLGPVPVTIR PA
2
529-537 (9) GAVPAPYYK PA
2
549-578 (30) QMQENLAPWGELATDNIILTVPTTNLQALK PA
2
586-596 (11) LWDEMMQAVAR PA
2
597-605 (9) LAAEPFPFR PA
2
610-635 (26) IVADVQISAGWMHSGYPIMCHLESVK PA
2
636-644 (9) EIINEMDMR PA
2
647-661 (15) GVWGPIHELGHNQQR PA
2
662-691 (30) HGWEFPPHTTEATCNLWSVYVHETVLGIPR PA
2
692-703 (12) AQAHEALSPPER PA
2
714-756 (43) GAPLCDWNVWTALETYLQLQEAFGWEPFTQLFAEYQTLSHLPK PA
1
776-790 (15) NLVPFFEAWGWPIQK PA
1
791-812 (22) EVADSLASLPEWQENPMQVYLR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center