Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NFT4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MAVPWEEYFR PA
0
21-34 (14) LPEQAEDHVPPVLR PA
0
40-53 (14) QELVDADQALQAQK PA
0
87-94 (8) FLQDSEAR PA
0
119-127 (9) LWTQLQELR PA
0
146-166 (21) LLEQALELLPGFQEVPELVAR PA
0
167-178 (12) FDGLAETQAALR PA
0
183-192 (10) EQLAELEAAR PA
0
200-212 (13) DAWPDEVLAQGQR PA
0
234-244 (11) WIQIQNTAAEK PA
0
253-285 (33) MAVLNLFQLVCQHQGQPPTLDIEDTEGQLEHVK PA
0
286-308 (23) LFMQDLSAMLAGLGQAEPAAPAS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center