Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NGB9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-39 (39) MPVPPPPPPPLPPPPPPLGAPPPPPPSAPPVSTDTSSLR PA
0
47-58 (12) SALLADIQQGTR PA
0
69-77 (9) SAPQIESSK PA
0
82-90 (9) EGGGSANTR PA
0
91-115 (25) GASTPPTLGDLFAGGFPVLRPAGQR PA
0
122-129 (8) TGQGPGSR PA
0
139-151 (13) TISGPLIPPASPR PA
0
152-163 (12) LGNTSEAHGAAR PA
0
164-197 (34) TAPPRPNVPAPPPPTPPPPPPPLPPPLPSSSPIK PA
0
198-209 (12) TPLVSPPGPLTK PA
0
210-246 (37) GNLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDK PA
0
247-276 (30) AVKPQLAPLHLPPIPPPLPLLPPCGYPGLK PA
0
277-305 (29) AEPASPAQDAQEPPAPPPPLPPYASCSPR PA
0
306-329 (24) ASLPAPPLPGVNSSSETPPPLPPK PA
0
330-339 (10) SPSFQAPPQK PA
0
340-360 (21) AGAQALPAPPAPPGSQPFLQK PA
0
363-372 (10) HGRPGAGGGK PA
0
373-382 (10) LNPPPAPPAR PA
0
383-391 (9) SPTTELSSK PA
0
392-409 (18) SQQATAWTPTQQPGGQLR PA
0
410-422 (13) NGSLHIIDDFESK PA
0
423-442 (20) FTFHSVEDFPPPDEYKPCQK PA
0
453-471 (19) TPGPWLQAEAVGQSSDDIK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center