Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NH21-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-36 (36) MSISSQHGITLASVEALHSSYCSWCLLQLLPIPGTR PA
0
42-69 (28) SGLLQASVISCYIMYLTFSALSSRPPER PA
1
70-86 (17) VILQGQNHTLCLPGLSK PA
1
87-129 (43) MEPQTPDISLAMLSASIMYACVLFACNEASYLAEVFGPLWIVK PA
1
130-152 (23) VYSYEFQKPSLCFCCPETVEADK PA
1
156-212 (57) GGAARPADQETPPAPPVQVQHLSYNYSAFHFVFFLASLYVMVTLTNWFSYEGAELEK PA
1
217-225 (9) GSWATFWVK PA
1
226-258 (33) VASCWACVLLYLGLLLAPLCWPPTQKPQPLILR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center