Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NHG9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-24 (24) MEEENATLLTEFVLTGFLYQPQWK PA
2
25-51 (27) IPLFLAFLVIYLITIMGNLGLIAVIWK PA
2
52-80 (29) DPHLHIPMYLLLGNLAFVDALLSSSVTLK PA
0
81-88 (8) MLINFLAK PA
1
91-98 (8) MISLSECK PA
2
99-122 (24) IQLFSFAISVTTECFLLATMAYDR PA
0
123-143 (21) YVAICKPLLYPAIMTNGLCIR PA
2
144-165 (22) LLILSYVGGLLHALIHEGFLFR PA
0
166-186 (21) LTFCNSNIIQHFYCDIIPLLK PA
1
187-227 (41) ISYTDSSINFLMVFIFAGSIQVFTIGTVLISYIFVLYTILK PA
0
237-293 (57) AFSTCGAHLLSVSLYYGPLAFMYMGSASPQADDQDMMESLFYTVIVPLLNPMIYSLR PA
0
296-303 (8) QVIASFTK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center