Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NHP3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
23-34 (12) QPHPQNEQSPQR PA
2
35-64 (30) STSGYPLQEVVDDEMLGPSAPGVDPSPPCR PA
2
73-84 (12) EWSDESEEEPEK PA
3
85-103 (19) ELAPEPEETWVVEMLCGLK PA
2
111-120 (10) VSSILPEHHK PA
1
121-137 (17) DFNSQLAPGVDPSPPHR PA
3
145-160 (16) MEWWDESEESLEEEPR PA
4
162-180 (19) VLAPEPEEIWVAEMLCGLK PA
5
188-201 (14) VSLVLPEHHEAFNR PA
5
202-209 (8) LLEDPVIK PA
7
224-235 (12) YLLAMVIAYFSR PA
8
236-245 (10) AGFPSWQYQR PA
5
246-266 (21) IHFFLALYLANDMEEDDEDSK PA
4
267-275 (9) QNIFHFLYR PA
4
286-298 (13) KPWFQLGHSMNPR PA
3
354-361 (8) SQIVLFQK PA
5
364-373 (10) FHFFCSMSCR PA
5
374-396 (23) AWVSPEELEEIQAYDPEHWVWAR PA
7
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center