Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NHR9-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-26 (26) MAAADGGGPGGASVGTEEDGGGVGHR PA
1
37-50 (14) ESELGDRPLQVGER PA
1
58-71 (14) ACVCQTLGISPEEK PA
1
72-79 (8) FVITTTSR PA
1
81-92 (12) EITCDNFDETVK PA
1
93-112 (20) DGVTLYLLQSVNQLLLTATK PA
1
115-126 (12) IDFLPHYDTLVK PA
1
127-158 (32) SGMYEYYASEGQNPLPFALAELIDNSLSATSR PA
1
169-187 (19) LLFDETQGKPAVAVIDNGR PA
1
193-201 (9) QLNNWAVYR PA
1
208-226 (19) QGDFESDHSGYVRPVPVPR PA
1
227-240 (14) SLNSDISYFGVGGK PA
1
241-251 (11) QAVFFVGQSAR PA
1
252-269 (18) MISKPADSQDVHELVLSK PA
1
280-288 (9) EAIYSGYIR PA
1
291-304 (14) KPSDSVHITNDDER PA
1
305-314 (10) FLHHLIIEEK PA
1
317-336 (20) DSFTAVVITGVQPEHIQYLK PA
1
337-344 (8) NYFHLWTR PA
1
345-358 (14) QLAHIYHYYIHGPK PA
1
367-383 (17) EVEPFNNIDIEISMFEK PA
1
394-414 (21) EIQDDMQTLYVNTAADSFEFK PA
1
415-428 (14) AHVEGDGVVEGIIR PA
1
429-436 (8) YHPFLYDR PA
1
437-448 (12) ETYPDDPCFPSK PA
1
451-463 (13) DEDDEDDCFILEK PA
1
469-479 (11) RPIFECFWNGR PA
1
480-496 (17) LIPYTSVEDFDWCTPPK PA
1
499-508 (10) GLAPIECYNR PA
1
509-518 (10) ISGALFTNDK PA
1
526-534 (9) LTFMDLELK PA
1
545-552 (8) ILNGQEQR PA
1
581-591 (11) GVITRPDLPSK PA
1
593-607 (15) QGPWATYAAIEWDGK PA
1
620-630 (11) TLPLFYGSIVR PA
1
631-662 (32) FFLYGDHDGEVYATGGEVQIAMEPQALYDEVR PA
1
681-688 (8) YVEDEMAR PA
1
693-719 (27) LSVTWPEGDELLPNEVRPAGTPIGALR PA
1
733-742 (10) LPGTSHGGSK PA
1
750-759 (10) VILHSSSGNK PA
1
760-771 (12) EIISHISQHGGK PA
1
792-812 (21) LQVVLNESNADTYAGRPLPSK PA
1
826-836 (11) FSFGLLDLPFR PA
1
837-879 (43) VGVPFNIPLEFQDEFGHTSQLVTDIQPVLEASGLSLHYEEITK PA
1
892-900 (9) GPVNSCQGK PA
1
932-965 (34) VKPDSEILVIENGTAFPFQVEVLDESDNITAQPK PA
1
972-1004 (33) FSGAPNLPVYVVDCSSSGTSILTGSAIQVQNIK PA
1
1030-1038 (9) LLPSSHVAR PA
1
1039-1048 (10) LQIFSVEGQK PA
1
1054-1079 (26) HQDEVNWIAGDIMHNLIFQMYDEGER PA
1
1080-1090 (11) EINITSALAEK PA
2
1093-1101 (9) VNWTPEINK PA
2
1102-1119 (18) EHLLQGLLPDVQVPTSVK PA
2
1123-1149 (27) YCQVSFQDDHVSLESAFTVRPLPDEPK PA
2
1160-1207 (48) TVQMGQELQGEVVIIITDQYGNQIQAFSPSSLSSLSIAGVGLDSSNLK PA
2
1208-1220 (13) TTFQENTQSISVR PA
2
1224-1232 (9) FIPGPPGNK PA
2
1247-1256 (10) VQLISGPPAK PA
2
1257-1266 (10) LLLIDWPELK PA
2
1267-1275 (9) ESIPVINGR PA
2
1276-1299 (24) DLQNPIIVQLCDQWDNPAPVQHVK PA
2
1310-1318 (9) LMPSNQQHK PA
2
1325-1336 (12) ANLGVFSVFAPR PA
2
1337-1344 (8) GEHTLQVK PA
2
1350-1358 (9) SIIEGPIIK PA
2
1359-1370 (12) LMILPDPEKPVR PA
2
1378-1403 (26) DASFLAGGLFTDFMISVISEDDSIIK PA
2
1417-1435 (19) LSTSGNRPPANAETFSCNK PA
2
1442-1449 (8) EDGCFYFR PA
2
1457-1470 (14) VGTYCIQFGFMMDK PA
2
1471-1490 (20) TNILNSEQVIVEVLPNQPVK PA
2
1495-1506 (12) IKPPTPAVSNVR PA
2
1516-1542 (27) DLHLSITDDYDNHTGIDLVGTIIATIK PA
2
1543-1557 (15) GSNEEDTDTPLFIGK PA
2
1560-1584 (25) TLEFPFVNGSAEIMSLVLAESSPGR PA
2
1585-1596 (12) DSTEYFIVFEPR PA
2
1603-1618 (16) TLEPYILPFMFYNDVK PA
2
1620-1628 (9) QQQMAALTK PA
2
1631-1641 (11) DQLSQSIVMYK PA
2
1642-1655 (14) SLFEASQQLLNEMK PA
2
1674-1693 (20) IHNIDIPTTQQVPHIEALLK PA
2
1696-1703 (8) LSEQEELK PA
2
1709-1717 (9) SCTLPNYTK PA
2
1718-1725 (8) GSGDVLGK PA
2
1726-1736 (11) IAHLAQIEDDR PA
2
1737-1761 (25) AAMVISWHLASDMDCVVTLTTDAAR PA
2
1763-1770 (8) IYDETQGR PA
2
1771-1781 (11) QQVLPLDSIYK PA
2
1799-1811 (13) LYFKPIGDPVFAR PA
2
1812-1847 (36) DLLTFPDNVEHCETVFGMLLGDTIILDNLDAANHYR PA
1
1853-1862 (10) ITHCPTLLTR PA
1
1888-1897 (10) GMVFGAPVPK PA
1
1898-1917 (20) QCLILGEQIVHACVPSYSGG PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center