Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NHR9-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MHNLIFQMYDEGER PA
0
15-25 (11) EINITSALAEK PA
2
28-36 (9) VNWTPEINK PA
2
37-54 (18) EHLLQGLLPDVQVPTSVK PA
2
58-84 (27) YCQVSFQDDHVSLESAFTVRPLPDEPK PA
2
95-142 (48) TVQMGQELQGEVVIIITDQYGNQIQAFSPSSLSSLSIAGVGLDSSNLK PA
2
143-155 (13) TTFQENTQSISVR PA
2
159-167 (9) FIPGPPGNK PA
2
182-191 (10) VQLISGPPAK PA
2
192-201 (10) LLLIDWPELK PA
2
202-210 (9) ESIPVINGR PA
2
211-234 (24) DLQNPIIVQLCDQWDNPAPVQHVK PA
2
245-253 (9) LMPSNQQHK PA
2
260-271 (12) ANLGVFSVFAPR PA
2
272-279 (8) GEHTLQVK PA
2
285-293 (9) SIIEGPIIK PA
2
294-305 (12) LMILPDPEKPVR PA
2
313-338 (26) DASFLAGGLFTDFMISVISEDDSIIK PA
2
352-370 (19) LSTSGNRPPANAETFSCNK PA
2
377-384 (8) EDGCFYFR PA
2
392-405 (14) VGTYCIQFGFMMDK PA
2
406-425 (20) TNILNSEQVIVEVLPNQPVK PA
2
430-441 (12) IKPPTPAVSNVR PA
2
451-477 (27) DLHLSITDDYDNHTGIDLVGTIIATIK PA
2
478-492 (15) GSNEEDTDTPLFIGK PA
2
495-519 (25) TLEFPFVNGSAEIMSLVLAESSPGR PA
2
520-531 (12) DSTEYFIVFEPR PA
2
538-553 (16) TLEPYILPFMFYNDVK PA
2
555-563 (9) QQQMAALTK PA
2
566-576 (11) DQLSQSIVMYK PA
2
577-590 (14) SLFEASQQLLNEMK PA
2
609-628 (20) IHNIDIPTTQQVPHIEALLK PA
2
631-638 (8) LSEQEELK PA
2
644-652 (9) SCTLPNYTK PA
2
653-660 (8) GSGDVLGK PA
2
661-671 (11) IAHLAQIEDDR PA
2
672-696 (25) AAMVISWHLASDMDCVVTLTTDAAR PA
2
698-705 (8) IYDETQGR PA
2
706-716 (11) QQVLPLDSIYK PA
2
734-746 (13) LYFKPIGDPVFAR PA
2
747-762 (16) DLLTFPDNVEHCETGC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center