Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NHX0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MELHILEHR PA
2
10-17 (8) LQVASVAK PA
0
18-29 (12) ESIPLFTYGLIK PA
0
41-98 (58) FFSLTETPEDYTIIVDEEGFLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGVTK PA
1
102-128 (27) SVIAPLADQNISVFMLSTYQTDFILVR PA
1
131-147 (17) DLPFVTHTLSSEFTILR PA
1
148-169 (22) VVNGETVAAENLGITNGFVKPK PA
1
170-185 (16) LVQRPVIHPLSSPSNR PA
1
186-214 (29) FCVTSLDPDTLPAVATLLMDVMFYSNGVK PA
1
215-227 (13) DPMATGDDCGHIR PA
1
228-249 (22) FFSFSLIEGYISLVMDVQTQQR PA
1
250-265 (16) FPSNLLFTSASGELWK PA
1
269-303 (35) IGGQPLGFDECGIVAQISEPLAAADIPAYYISTFK PA
1
304-322 (19) FDHALVPEENINGVISALK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center