Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NIJ9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-54 (48) QIEFILLGLTDNSQLQIVIFLFLLLNCVLSMIGNFTIIALILLDSQLK PA
0
55-62 (8) TPMYFFLR PA
5
63-78 (16) NFSFLEISFTTACIPR PA
0
79-86 (8) FLITIVTR PA
1
89-120 (32) TISCNGCISQLFFYIFLGVTEFFLLAALSYDR PA
0
121-129 (9) YVAICKPLR PA
1
130-137 (8) YMSIMSNK PA
0
138-221 (84) VCYQLVFSSWVTGFLIIFTPLILGLNLDFCASNIIDHFICDISLILQLSCSDTHLLELIAFLLAVMTLIVTLFLVILSYSYIIK PA
0
235-265 (31) AFSTCSSHMIVVSITYGSCMFIYIKPSANER PA
0
271-291 (21) GVTVLNTSVAPLLNPFIYTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center