Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NJB7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MDTQGPVSQPFQQPEKPGR PA
1
38-50 (13) RPLAHHDPPVAIR PA
1
51-60 (10) DPPVVPTASK PA
1
61-68 (8) LVVITQGR PA
1
75-82 (8) GLFNHEVK PA
1
89-112 (24) LLSSGTLVPGSPTLPAKPSPSPGR PA
1
124-163 (40) ENQVPGGSGPGPPSSPELSGVGQLLAELQCQLSLPQAFPR PA
1
172-193 (22) DAIVHTLQACHGCVPDLALVLR PA
1
194-209 (16) GCQPPLPGAKPGVSER PA
0
211-227 (17) MTPFWINSPDQVPEQER PA
0
236-252 (17) EFTFPMPYTSSMPTAHR PA
0
260-287 (28) GPWPPYFPSLSSPSGTAWGPPTAFDLLK PA
0
288-319 (32) SIWLVATPPPPRPWGVGLPQPLPQPSSPLLPR PA
0
320-354 (35) TSVLDWSPSPPSPLPSLSWVVAQSSPEAWSFPPMR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center