Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NJG6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-18 (14) MAPENPQPDPFINR PA
0
25-41 (17) VIPPQDPASPSFTLLSK PA
0
42-68 (27) LECSGTVSAYCSLNLPGSTDPPTSASR PA
0
69-76 (8) VAATTAIR PA
0
83-105 (23) TSFTHQQYEELEALFSQTMFPDR PA
0
115-123 (9) LDLPESTVK PA
0
136-143 (8) QQQQQSAK PA
0
161-212 (52) TSPSPYAFSPVISDFYSSLPSQPLDPSNWAWNSTFTESSTSDFQMQDTQWER PA
0
213-258 (46) LVASVPALYSDAYDIFQIIELYNLPDENEISSSSFHCLYQYLSPTK PA
0
259-305 (47) YQVGGQGSSLSIFAGPAVGLSPAQTWPNMTSQAFEAYSLTDSLEFQK PA
0
306-315 (10) TSNMVDLGFL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center