Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NJJ6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-36 (36) MATEQWFEGSLPLDPGETPPPDALEPGTPPCGDPSR PA
0
37-57 (21) STPPGRPGNPSEPDPEDAEGR PA
0
63-81 (19) ASTSSPKPLVPRPGPAPPR PA
0
82-96 (15) LSLDTLFSPITQQLR PA
0
102-113 (12) ADDFQSYLLYSR PA
0
124-144 (21) AMPTFLQMCEPYFLYLEAAAR PA
0
145-158 (14) SIPPIYGPLQELVR PA
0
160-171 (12) GLLEISQQLTLR PA
0
172-202 (31) LEQLVLMYASFGFVDLEEMNPLSISCFFCGR PA
0
203-215 (13) FSISLSHEVSIFR PA
0
216-226 (11) YCAPTAYTASR PA
0
237-248 (12) WHLEATPEAPGR PA
0
249-262 (14) GQDSLVDYYFLCYR PA
0
263-281 (19) DTWEDTGQSPANSCPQIQK PA
0
288-358 (71) WVPLGPAEDDLYSWILCPQPLGDYQQLLTIGFEEPTPTLATDLLVQILTGQAGQARPPSAAGPAGWAAQGS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center