Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NM76-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-54 (50) TSVTDFILLGLTDNPQLQVVIFSFLFLTYVLSVTGNLTIISLTLLDSHLK PA
0
55-62 (8) TPMYFFLR PA
5
63-77 (15) NFSLEISFTSVCNPR PA
0
78-87 (10) FLISILTGDK PA
0
88-136 (49) SISYNACAAQLFFFIFLGSTEFFLLASMSYDCYVAICKPLHYTTIMSDR PA
0
137-220 (84) ICYQLIISSWLAGFLVIFPPLAMGLQLDFCDSNVIDHFTCDSAPLLQISCTDTSTLELMSFILALFTLISTLILVILSYTYIIR PA
0
234-258 (25) AFSTCSSHVIVVSISYGSCIFMYVK PA
0
270-290 (21) GVAILNTSVAPMLNPFIYTLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center