Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NMS3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-24 (21) ENHSLAAEFILIGFTNYPELK PA
0
25-53 (29) TLLFVVFSAIYLVTMVGNLGLVALIYVER PA
0
55-80 (26) LLTPMYIFLGNLALMDSCCSCAVTPK PA
0
81-90 (10) MLENFFSEDR PA
0
91-122 (32) IISLYECMAQFYFLCLAETTDCFLLATMAYDR PA
0
123-138 (16) YVAICHPLQYHTMMSK PA
0
151-165 (15) AGNLHSMIHVGLLLR PA
0
174-186 (13) IHHFFCDILPLYR PA
0
187-227 (41) LSCTDPSINELMIYIFSIPIQIFTIATVLISYLCILLTVFK PA
0
237-267 (31) AFSTCASHFLSVSIFYICLLMYIGPSEEGDK PA
0
268-290 (23) DTPVAIFYAIVIPLLNPFIYSLR PA
0
310-321 (12) QTCSIANLFLIY PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center