Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NMV5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
20-46 (27) DQALAMSTLEELPTELFPPLFMEAFSR PA
5
54-62 (9) LMVQAWPFR PA
5
64-71 (8) LPLRPLIK PA
6
72-96 (25) MPCLEAFQAVLDGLDALLTQGVHPR PA
2
100-129 (30) LQVLDLQDVCENFWMVWSEAMAHGCFLNAK PA
4
133-140 (8) KPVQDCPR PA
5
143-156 (14) GQQPLTVFVELWLK PA
2
159-172 (14) TLDEYLTCLLLWVK PA
4
176-183 (8) DLLHLCCK PA
7
201-215 (15) MVNLDCIQEVEVNCK PA
7
216-232 (17) WVLPILTQFTPYLGHMR PA
6
237-246 (10) LVLSHMDVSR PA
6
255-266 (12) EIVTQFTTQFLK PA
7
273-293 (21) LSMNSVSFLEGHLDQLLSCLK PA
2
298-312 (15) VLTITNCVLLESDLK PA
6
313-324 (12) HLSQCPSISQLK PA
7
325-332 (8) TLDLSGIR PA
7
333-347 (15) LTNYSLVPLQILLEK PA
7
348-406 (59) VAATLEYLDLDDCGIIDSQVNAILPALSCCFELNTFSFCGNPISMATLENLLSHTIILK PA
0
407-417 (11) NLCVELYPAPR PA
4
418-430 (13) ESYDADGTLCWSR PA
2
451-464 (14) ILFCTDCCPDCGNR PA
2
465-476 (12) SFYDLEADQCCC PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center