Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NN92-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-32 (25) NFYEGCVKPPTVIGQFHTLFFGSIR PA
0
33-57 (25) IFFLGVLGFAVYGNEALHFICDPDK PA
0
59-99 (41) EVNLFCYNQFRPITPQVSFSALQLVIVLVPGALFHLYAACK PA
0
100-123 (24) SINQECILQKPIYTIIYILSVLLR PA
0
124-143 (20) ISLAAIAFWLQIYLFGFQVK PA
0
144-151 (8) SLYLCDAR PA
0
152-160 (9) SLGENMIIR PA
0
161-169 (9) CMVPEHFEK PA
0
170-197 (28) TIFLIAINTFTTITILLFVAEIFEIIFR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center