Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NNA2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-34 (34) MSSTVNNGAASMQSTPDAANGFPQPSSSSGTWPR PA
0
41-48 (8) AAEPGLVK PA
0
67-85 (19) CMELQEMMEEQGYSEEEIR PA
0
105-118 (14) EDRPGGHIVAETPR PA
0
119-149 (31) LTEGAEPGLEYAPFDDDDGPVDCDCPASCYR PA
0
158-169 (12) HWSSSSASPPPK PA
0
187-200 (14) LESECSCGSSSPLR PA
0
242-250 (9) RPHTESPGR PA
0
255-273 (19) HSSGSSHSPSLSSHYSDSR PA
0
299-313 (15) SPSPSGGSGWGSPQR PA
0
321-344 (24) SGAHGGRPGSAHSPPDKPSSPSPR PA
0
349-359 (11) AAAAAPTPPAR PA
0
368-375 (8) SAPSSQGR PA
0
410-417 (8) RPRPAPPR PA
0
428-436 (9) SSSDSGSGR PA
0
437-449 (13) GAPGPGPEPGSER PA
0
465-479 (15) ARPASTSPSPGAHGR PA
0
542-549 (8) HSEAEATR PA
0
566-574 (9) DSPSFMEPR PA
0
576-597 (22) ITSAASVLFHTTGPAPLPPPAA PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center