Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NNM3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-14 (11) DSPSPLGASPK PA
2
15-30 (16) KPGCSSPAAAVLENQR PA
2
90-97 (8) QLQEEMQR PA
2
116-123 (8) QLQQLLHR PA
2
138-146 (9) QLAEELVNR PA
2
147-163 (17) GHCSRPGASEVSAAQCR PA
2
166-174 (9) LQEVLAQLR PA
2
175-184 (10) WQTDGEQAAR PA
2
187-196 (10) YLQAALEVER PA
2
209-259 (51) GHPALSGSPDPQAVHSLEEPLPQTSSGSCHAPKPACQLGSLDSLSAEVGVR PA
2
262-294 (33) SLGLVSSACSSSPDGLLSTHASSLDCFAPACSR PA
2
308-323 (16) SEERPSSPDTSTPGSR PA
2
325-342 (18) LSPPPSPLPPPPPPSAHR PA
2
349-375 (27) GGEGSESQPCEVLTPSPPGLGHHELIK PA
2
391-399 (9) CYTLQEENK PA
1
404-413 (10) AGCPYQADEK PA
2
422-429 (8) AELTGLAR PA
2
437-444 (8) ELQETNLR PA
1
445-466 (22) AVSAPIPGESCAGLELCQVFAR PA
2
471-482 (12) DLSEQASAPLAK PA
2
491-499 (9) QECHLLQAR PA
2
500-512 (13) VASGPCSDLHTGR PA
2
513-523 (11) GGPCTQWLNVR PA
2
542-567 (26) QLMLQQGNGGAWPEAGGQSATCEEVR PA
2
583-595 (13) ECQELGTQAAPAR PA
1
598-611 (14) GEEAETQLQAALLK PA
2
612-621 (10) NAWLAEENGR PA
2
632-640 (9) VEAENSEVR PA
2
651-666 (16) DASGLIAEQLLQQAAR PA
2
681-690 (10) ALCDLHPSWK PA
2
691-718 (28) EIQALQCRPGHPPEQPWETSQMPESQVK PA
2
725-739 (15) FHARPEDYAVSQPNR PA
2
746-777 (32) EASLEESPVALGESASVPQVSETVPASQPLSK PA
2
779-803 (25) TSSQSNSSSEGSMWATVPSSPTLDR PA
2
804-833 (30) DTASEVDDLEPDSVSLALEMGGSAAPAAPK PA
2
836-885 (50) IFMAQYNYNPFEGPNDHPEGELPLTAGDYIYIFGDMDEDGFYEGELDDGR PA
1
887-909 (23) GLVPSNFVEQIPDSYIPGCLPAK PA
2
910-935 (26) SPDLGPSQLPAGQDEALEEDSLLSGK PA
2
954-964 (11) TEVATEILDTK PA
2
965-978 (14) TEACQLGLLQSMGK PA
2
979-989 (11) QGLSRPLLGTK PA
2
994-1019 (26) MAPMQLHLQNVTATSANITWVYSSHR PA
2
1020-1029 (10) HPHVVYLDDR PA
2
1030-1053 (24) EHALTPAGVSCYTFQGLCPGTHYR PA
2
1060-1096 (37) LPWDLLQVYWGTMSSTVTFDTLLAGPPYPPLEVLVER PA
0
1097-1134 (38) HASPGVLVVSWLPVTIDSAGSSNGVQVTGYAVYADGLK PA
2
1135-1161 (27) VCEVADATAGSTVLEFSQLQVPLTWQK PA
1
1166-1190 (25) TMSLCGESLDSVPAQIPEDFFMCHR PA
2
1191-1208 (18) WPETPPFSYTCGDPSTYR PA
2
1209-1217 (9) VTFPVCPQK PA
2
1218-1226 (9) LSLAPPSAK PA
2
1227-1241 (15) ASPHNPGSCGEPQAK PA
2
1242-1252 (11) FLEAFFEEPPR PA
2
1254-1286 (33) QSPVSNLGSEGECPSSGAGSQAQELAEAWEGCR PA
2
1294-1310 (17) SPQNHRPPSVSDQPGEK PA
2
1311-1321 (11) ENCYQHMGTSK PA
1
1322-1331 (10) SPAPGFIHLR PA
2
1355-1380 (26) QDAQGFTPPQLGASQQYASDFHNVLK PA
2
1381-1391 (11) EEQEALCLDLR PA
1
1408-1415 (8) QGQALGVK PA
2
1417-1434 (18) GCQLHEPSSALCPAPSAK PA
2
1441-1455 (15) GGPQQLGTGANTPAR PA
2
1456-1473 (18) VFVALSDYNPLVMSANLK PA
2
1474-1483 (10) AAEEELVFQK PA
2
1489-1505 (17) VWGSQDTHDFYLSECNR PA
2
1506-1513 (8) QVGNIPGR PA
2
1514-1527 (14) LVAEMEVGTEQTDR PA
2
1531-1564 (34) SPAQGHLPSVAHLEDFQGLTIPQGSSLVLQGNSK PA
0
1573-1592 (20) IMIAALDYDPGDGQMGGQGK PA
2
1599-1623 (25) AGDVVMVYGPMDDQGFYYGELGGHR PA
2
1624-1639 (16) GLVPAHLLDHMSLHGH PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center