Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NNN8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MEGQTPGSR PA
0
10-35 (26) GLPEKPHPATAAATLSSMGAVFILMK PA
0
36-51 (16) SALGAGLLNFPWAFSK PA
0
52-93 (42) AGGVVPAFLVELVSLVFLISGLVILGYAAAVSGQATYQGVVR PA
0
94-102 (9) GLCGPAIGK PA
0
103-121 (19) LCEACFLLNLLMISVAFLR PA
0
122-129 (8) VIGDQLEK PA
0
130-150 (21) LCDSLLSGTPPAPQPWYADQR PA
0
151-168 (18) FTLPLLSVLVILPLSAPR PA
0
175-204 (30) YTSILGTLAACYLALVITVQYYLWPQGLVR PA
0
205-243 (39) ESHPSLSPASWTSVFSVFPTICFGFQCHEAAVSIYCSMR PA
0
246-299 (54) SLSHWALVSVLSLLACCLIYSLTGVYGFLTFGTEVSADVLMSYPGNDMVIIVAR PA
0
300-318 (19) VLFAVSIVTVYPIVLFLGR PA
0
319-326 (8) SVMQDFWR PA
0
328-347 (20) SCLGGWGPSALADPSGLWVR PA
0
348-403 (56) MPLTILWVTVTLAMALFMPDLSEIVSIIGGISSFFIFIFPGLCLICAMGVEPIGPR PA
0
406-435 (30) CCLEVWGVVSVLVGTFIFGQSTAAAVWEMF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center