Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6NNZ2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-19 (17) EIVLTQTGQCGNQIGAK PA
0
20-46 (27) FWEVISDEHAIDSAGTYHGDSHLQLER PA
1
47-58 (12) INVHHHEASGGR PA
0
63-103 (41) AVLVDLEPGTMDSVHSGPFGQVFRPDNFISGQCGAGNNWAK PA
0
106-121 (16) YTEGAELTESVMDVVR PA
0
123-154 (32) EAESCDCLQGFQLTHSLGGGTGSGMGTLLISK PA
3
163-174 (12) IINTFSILPSPK PA
1
175-213 (39) VSDTVVEPYNATLSVHQLIENADETFCIDNEALYDICSR PA
0
217-241 (25) LPTPTYGDLNHLVSATMSGVTTCLR PA
1
242-251 (10) FPGQLNADLR PA
10
253-262 (10) LAVNMVPFPR PA
10
263-276 (14) LHFFMPGFAPLTSR PA
7
283-297 (15) ALTVAELTQQMFDAK PA
1
298-306 (9) NMMAACDPR PA
9
307-318 (12) HGCYLTVAAIFR PA
0
325-336 (12) EVDEQMFNIQDK PA
1
337-350 (14) NSSYFADWFPDNVK PA
0
351-359 (9) TAVCDIPPR PA
6
363-390 (28) MSATFIGNNAAIQELFTCVSEQFTAMFR PA
0
393-444 (52) AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDEEYAEEEVA PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center