Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6PVC2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-19 (13) GLSLASSSDGDGR PA
0
26-37 (12) QGISQDLASSSR PA
0
57-68 (12) IFSIYGHYPVVR PA
1
87-97 (11) VIPDVEDEGAR PA
1
98-105 (8) VNDDTCAK PA
1
108-116 (9) ENQEMALEK PA
1
117-126 (10) TDNIHDVMSR PA
1
130-140 (11) NEMPYLLWTIK PA
1
142-160 (19) DIIDYHSLTYDQMLNHYAK PA
1
168-175 (8) IGLCVNMR PA
1
176-191 (16) SLPWYVPANPDSFFPR PA
1
192-209 (18) CYSLCTESEQQEFLEDFR PA
1
211-218 (8) TMASSILK PA
1
219-228 (10) WVVSHQSCSR PA
1
239-249 (11) EEAGSSDLSSR PA
1
250-258 (9) QDAENAEAK PA
1
261-272 (12) GLPGQLVDIACK PA
1
273-322 (50) VCQAYLGQLEHEDIDTSADAVEDLTEAEWEDLTQQYYSLVHGDAFISNSR PA
0
323-334 (12) NYFSQCQALLNR PA
0
335-348 (14) ITSVNPQTDIDGLR PA
1
349-358 (10) NIWIIKPAAK PA
1
370-385 (16) VEEILELAAADHPLSR PA
1
394-405 (12) YIETPLLICDTK PA
1
410-426 (17) QWFLVTDWNPLTIWFYK PA
1
442-455 (14) LDSAIHLCNNAVQK PA
1
464-477 (14) SPLLPAHNMWTSTR PA
1
488-500 (13) GAVWGSVIYPSMK PA
1
509-517 (9) VAQDHVEPR PA
1
519-532 (14) NSFELYGADFVLGR PA
1
533-567 (35) DFRPWLIEINSSPTMHPSTPVTAQLCAQVQEDTIK PA
1
573-584 (12) SCDIGNFELLWR PA
1
585-606 (22) QPVVEPPPFSGSDLCVAGVSVR PA
1
611-619 (9) QVLPVCNLK PA
1
620-631 (12) ASASLLDAQPLK PA
1
634-652 (19) GPSAMPDPAQGPPSPALQR PA
1
661-671 (11) GLPLALLAPLR PA
1
672-684 (13) GAAESGGAAQPTR PA
1
691-699 (9) VELPACPCR PA
1
700-717 (18) HVDSQAPNTGVPVAQPAK PA
1
718-734 (17) SWDPNQLNAHPLEPVLR PA
1
738-750 (13) TAEGALRPPPGGK PA
1
751-758 (8) GEGTVCSR PA
1
759-786 (28) LPHHGHHVAACQTTGTTWDGGPGVCFLR PA
1
787-801 (15) QLLASELPMGPGLPR PA
1
805-812 (8) APPCLVCR PA
1
813-822 (10) GLLPPAGPCK PA
1
826-839 (14) SFCAAVLQGASFVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center