Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6PVC2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-19 (8) YSENACEK PA
0
21-32 (12) IFSIYGHYPVVR PA
1
51-61 (11) VIPDVEDEGAR PA
1
62-69 (8) VNDDTCAK PA
1
72-80 (9) ENQEMALEK PA
1
81-90 (10) TDNIHDVMSR PA
1
94-104 (11) NEMPYLLWTIK PA
1
106-124 (19) DIIDYHSLTYDQMLNHYAK PA
1
132-139 (8) IGLCVNMR PA
1
140-155 (16) SLPWYVPANPDSFFPR PA
1
156-173 (18) CYSLCTESEQQEFLEDFR PA
1
175-182 (8) TMASSILK PA
1
183-192 (10) WVVSHQSCSR PA
1
203-213 (11) EEAGSSDLSSR PA
1
214-222 (9) QDAENAEAK PA
1
225-236 (12) GLPGQLVDIACK PA
1
237-290 (54) VCQAYLGQLEHEDIDTSADAVEDLTEAEWEDLTQQYYSLVQVPLGSSIVLCIFK PA
0
294-304 (11) VMMSFEPPTAR PA
0
307-314 (8) QCQALLNR PA
0
315-328 (14) ITSVNPQTDIDGLR PA
1
329-338 (10) NIWIIKPAAK PA
1
343-353 (11) GESPDIVCMDR PA
0
354-369 (16) VEEILELAAADHPLSR PA
1
378-389 (12) YIETPLLICDTK PA
1
394-410 (17) QWFLVTDWNPLTIWFYK PA
1
426-439 (14) LDSAIHLCNNAVQK PA
1
448-461 (14) SPLLPAHNMWTSTR PA
1
472-484 (13) GAVWGSVIYPSMK PA
1
493-501 (9) VAQDHVEPR PA
1
503-516 (14) NSFELYGADFVLGR PA
1
517-551 (35) DFRPWLIEINSSPTMHPSTPVTAQLCAQVQEDTIK PA
1
557-568 (12) SCDIGNFELLWR PA
1
569-590 (22) QPVVEPPPFSGSDLCVAGVSVR PA
1
595-603 (9) QVLPVCNLK PA
1
604-615 (12) ASASLLDAQPLK PA
1
618-636 (19) GPSAMPDPAQGPPSPALQR PA
1
645-655 (11) GLPLALLAPLR PA
1
656-668 (13) GAAESGGAAQPTR PA
1
675-683 (9) VELPACPCR PA
1
684-701 (18) HVDSQAPNTGVPVAQPAK PA
1
702-718 (17) SWDPNQLNAHPLEPVLR PA
1
722-734 (13) TAEGALRPPPGGK PA
1
735-742 (8) GEGTVCSR PA
1
743-770 (28) LPHHGHHVAACQTTGTTWDGGPGVCFLR PA
1
771-785 (15) QLLASELPMGPGLPR PA
1
789-796 (8) APPCLVCR PA
1
797-806 (10) GLLPPAGPCK PA
1
810-823 (14) SFCAAVLQGASFVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center