Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6XGL0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MSSAAGPDPSEAPEER PA
1
21-33 (13) ALELQPPLADMGR PA
0
34-47 (14) AELSSNATTSLVQR PA
1
55-79 (25) QSWLEQIWNAGPVCQSTAEAAALER PA
0
90-106 (17) QQLVELCGHASAVAVTK PA
1
107-115 (9) AFPLPALSR PA
1
119-138 (20) TVLVVCGPEQNGAVGLVCAR PA
1
142-154 (13) VFEYEPTIFYPTR PA
1
162-169 (8) DLTTQCEK PA
1
170-212 (43) MDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTR PA
1
219-257 (39) LLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPK PA
1
287-299 (13) LPGYTGTDCVAAL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center