Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A6XGL0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MSSAAGPDPSEAPEER PA
1
17-29 (13) HFLSTAEAAALER PA
0
40-56 (17) QQLVELCGHASAVAVTK PA
1
57-65 (9) AFPLPALSR PA
1
69-88 (20) TVLVVCGPEQNGAVGLVCAR PA
1
92-104 (13) VFEYEPTIFYPTR PA
1
112-119 (8) DLTTQCEK PA
1
120-162 (43) MDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTR PA
1
169-207 (39) LLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPK PA
1
237-249 (13) LPGYTGTDCVAAL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center