Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8K979-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-27 (11) SIAPANGNLGR PA
2
32-51 (20) QLFDYLIVIDFESTCWNDGK PA
2
52-100 (49) HHHSQEIIEFPAVLLNTSTGQIDSEFQAYVQPQEHPILSEFCMELTGIK PA
2
101-111 (11) QAQVDEGVPLK PA
3
112-119 (8) ICLSQFCK PA
3
129-145 (17) NIIFATGISEPSASEVK PA
3
146-166 (21) LCAFVTWSDWDLGVCLEYECK PA
3
169-183 (15) QLLKPVFLNSWIDLR PA
3
196-211 (16) GLSGALQEVGIEFSGR PA
3
212-220 (9) EHSGLDDSR PA
3
221-228 (8) NTALLAWK PA
3
257-281 (25) NLNTIQVEEMSACNISIQGPSIYNK PA
1
285-292 (8) NIINPHEK PA
1
297-305 (9) SICANSPIK PA
1
306-314 (9) AQQDQLQVK PA
1
326-334 (9) SSLPLFNTK PA
1
335-355 (21) SSTSVGQLQSPTLNSPIYMQK PA
1
359-367 (9) NEHLAFNTK PA
1
370-443 (74) ASTVGSELVLVSTTVPTVHHVSDLEMSSTLDCLPVLADWEDVVLLPASQPEENVDCTVPISDSDLEISFNSGER PA
1
449-467 (19) ELEMSSHENFGDIEETPQK PA
1
478-487 (10) SPHTTIYNVK PA
1
491-500 (10) DPGSDISAFK PA
1
512-524 (13) VNANMSHPLVLGK PA
1
525-533 (9) HPLLSGGTK PA
1
535-546 (12) NPCSPQAFPPAK PA
1
548-566 (19) QPFTIHEEKPTSSDCSPVR PA
1
573-588 (16) LPSILTSTVNLQEPWK PA
1
606-617 (12) LVVSNNGPNHGK PA
1
618-626 (9) VFYCCPIGK PA
1
648-673 (26) ANSMVPSHSTGGLTFSSPETSHICDR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center