Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8K979-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-18 (11) QAQVDEGVPLK PA
3
19-26 (8) ICLSQFCK PA
3
36-52 (17) NIIFATGISEPSASEVK PA
3
53-73 (21) LCAFVTWSDWDLGVCLEYECK PA
3
76-90 (15) QLLKPVFLNSWIDLR PA
3
103-118 (16) GLSGALQEVGIEFSGR PA
3
119-127 (9) EHSGLDDSR PA
3
128-135 (8) NTALLAWK PA
3
164-188 (25) NLNTIQVEEMSACNISIQGPSIYNK PA
1
192-199 (8) NIINPHEK PA
1
204-212 (9) SICANSPIK PA
1
213-221 (9) AQQDQLQVK PA
1
233-241 (9) SSLPLFNTK PA
1
242-262 (21) SSTSVGQLQSPTLNSPIYMQK PA
1
266-274 (9) NEHLAFNTK PA
1
277-350 (74) ASTVGSELVLVSTTVPTVHHVSDLEMSSTLDCLPVLADWEDVVLLPASQPEENVDCTVPISDSDLEISFNSGER PA
1
356-374 (19) ELEMSSHENFGDIEETPQK PA
1
385-394 (10) SPHTTIYNVK PA
1
398-407 (10) DPGSDISAFK PA
1
419-431 (13) VNANMSHPLVLGK PA
1
432-440 (9) HPLLSGGTK PA
1
442-453 (12) NPCSPQAFPPAK PA
1
455-473 (19) QPFTIHEEKPTSSDCSPVR PA
1
480-495 (16) LPSILTSTVNLQEPWK PA
1
513-524 (12) LVVSNNGPNHGK PA
1
525-533 (9) VFYCCPIGK PA
1
555-580 (26) ANSMVPSHSTGGLTFSSPETSHICDR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center