Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8K979-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-27 (11) SIAPANGNLGR PA
2
32-51 (20) QLFDYLIVIDFESTCWNDGK PA
2
52-100 (49) HHHSQEIIEFPAVLLNTSTGQIDSEFQAYVQPQEHPILSEFCMELTGIK PA
2
101-111 (11) QAQVDEGVPLK PA
3
112-119 (8) ICLSQFCK PA
3
129-145 (17) NIIFATGISEPSASEVK PA
3
146-166 (21) LCAFVTWSDWDLGVCLEYECK PA
3
169-183 (15) QLLKPVFLNSWIDLR PA
3
196-211 (16) GLSGALQEVGIEFSGR PA
3
212-220 (9) EHSGLDDSR PA
3
221-228 (8) NTALLAWK PA
3
262-269 (8) NNPSLFMK PA
0
271-279 (9) SLHHLIAPQ PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center